KEGG   Escherichia coli BL21(DE3): ECD_03257Help
Entry
ECD_03257         CDS       T00931                                 

Gene name
ompR
Definition
(GenBank) response regulator in two-component regulatory system with EnvZ
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl02020  Two-component system
ebl02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECD_03257 (ompR)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECD_03257 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ebl02022]
    ECD_03257 (ompR)
Two-component system [BR:ebl02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ECD_03257 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ACT45060
Structure
PDB: 

Position
complement(3396245..3396964)
Genome map
AA seq 239 aa AA seqDB search
MQENYNILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaatattctggtggtcgatgacgacatgcgcctgcgtgcgctgctg
gaacgttatctcaccgaacaaggcttccaggttcgaagcgtcgctaatgcagaacagatg
gatcgcctgctgactcgtgaatctttccatcttatggtactggatttaatgttacctggt
gaagatggcttgtcgatttgccgacgtcttcgtagtcagagcaacccgatgccgatcatt
atggtgacggcgaaaggggaagaagtggaccgtatcgtaggcctggagattggcgctgac
gactacattccaaaaccgtttaacccgcgtgaactgctggcccgtatccgtgcggtgctg
cgtcgtcaggcgaacgaactgccaggcgcaccgtcacaggaagaggcggtaattgctttc
ggtaagttcaaacttaacctcggtacgcgcgaaatgttccgcgaagacgagccgatgccg
ctcaccagcggtgagtttgcggtactgaaggcactggtcagccatccgcgtgagccgctc
tcccgcgataagctgatgaaccttgcccgtggtcgtgaatattccgcaatggaacgctcc
atcgacgtgcagatttcgcgtctgcgccgcatggtggaagaagatccagcgcatccgcgt
tacattcagaccgtctggggtctgggctacgtctttgtaccggacggctctaaagcatga

DBGET integrated database retrieval system