KEGG   Erysipelotrichaceae bacterium SG0102: SG0102_03480Help
Entry
SG0102_03480      CDS       T05736                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ebm  Erysipelotrichaceae bacterium SG0102
Pathway
ebm00670  One carbon pool by folate
ebm01100  Metabolic pathways
ebm01120  Microbial metabolism in diverse environments
ebm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ebm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SG0102_03480 (metF)
Enzymes [BR:ebm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SG0102_03480 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: BBH25414
UniProt: A0A3G9JRI5
Position
356641..357501
Genome map
AA seq 286 aa AA seqDB search
MKIIDRLQEDKITLSFEVFPPKYSKNYDAVSQKALEIAKLHPDFMSVTYGAGGGTSEYTV
NIAKEIQQREGVDVLAHLTCVSSTKEKVHNMLEIFKANGIENIMALRGDLPDGETPHHYE
HASELIKEIKAFDPNFCIGGACYPEGHPEAHNKNVDIENLKKKIDAGCDFLTSQMFFDNA
IFYNFLFRAREAGIQVPIVAGIMPITRKEQVKRAIQLSGSSVPGRFVSMVDAFGDNEPAM
KQAGIIYATEQITDLIANGVKHIHVYTMNKPDVAKGIMDNLSEILK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattattgatcgtttacaggaagacaaaatcacattatcatttgaagtctttcca
ccaaaatattccaagaactatgacgctgtttcgcagaaagccttagagattgccaagctg
catccggattttatgtccgtgacctacggcgccggcggcggaacgagtgaatataccgtg
aatatcgccaaagagatccagcaaagggaaggcgttgacgtcttagcccatttaacatgc
gtctcttccaccaaagagaaagtgcataatatgttagagatctttaaagcgaatggcatt
gaaaatattatggccttacgtggtgatttgccagatggagaaacaccgcatcattatgaa
catgcctcagaactgattaaagaaatcaaagcctttgatccgaatttctgtattggcgga
gcctgttatccagaaggacatccagaagcacataataaaaatgtggatatcgaaaatctc
aaaaagaaaatcgatgcgggctgtgatttcttaacctcccagatgttctttgacaatgcc
atcttctacaatttcttattccgcgcacgggaagcaggcatccaagtgccgattgtggcg
ggcattatgccaatcactagaaaagagcaagtaaaacgggcgatccagttatctggctcc
agtgtgccaggtcgtttcgtgtccatggttgatgcctttggcgacaatgaaccagcgatg
aaacaggctggtattatctatgcgaccgagcagattacggatctgatcgctaacggggtt
aaacatattcatgtttatacgatgaataaaccagatgtggccaaaggcattatggataac
ttatcggagattttgaagtaa

DBGET integrated database retrieval system