KEGG   Erysipelotrichaceae bacterium SG0102: SG0102_08500Help
Entry
SG0102_08500      CDS       T05736                                 

Definition
(GenBank) hypothetical protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ebm  Erysipelotrichaceae bacterium SG0102
Pathway
ebm00860  Porphyrin and chlorophyll metabolism
ebm01100  Metabolic pathways
ebm01110  Biosynthesis of secondary metabolites
ebm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SG0102_08500
Enzymes [BR:ebm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SG0102_08500
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SG0102_08500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M TrkA_N Lycopene_cycl Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: BBH25916
UniProt: A0A3G9J557
Position
905133..905759
Genome map
AA seq 208 aa AA seqDB search
MAYFPMFINLENVPVLIVGGGTTALRKAEKLSYFKPRLHVIALSYQPAMLSFLNKHHYSY
EERAFEKEDLEGMQMVIAATNDASVNASIAFLAKAKHIPINSVDDLDHCSFLFPSLYTNE
DIVCGISSGGHSPVISQEIRKILEAQVPDDFGIINARLGKLRENVKKKGTMASRKAFYHQ
VIDLLLEEPEMSEEALADYCERYFQNED
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcttattttcccatgtttatcaatttagaaaacgtccctgttttaattgtcggcggc
gggacaacggctttgcgtaaagcggagaaactctcttattttaagcctcgcttacatgtt
attgcattatcttatcagccggcgatgctttcttttttaaataagcatcattattcttat
gaagaaagagcttttgaaaaagaggacttagaagggatgcagatggtcattgcggcgacc
aatgacgcgagcgtcaatgcaagcatcgcttttctcgccaaggctaagcatattccgatt
aatagcgtggatgatttagatcactgcagttttctttttccttccttatataccaatgaa
gatattgtctgtgggatttcctctggcggacattcgccagtcatcagtcaggagatcaga
aaaatcttagaagcgcaggtgcctgatgatttcggtatcatcaatgcccggttaggtaag
ctgagagagaatgtgaaaaagaaaggaacaatggcctcgagaaaagctttttaccatcag
gtgatcgatttactgttagaggagccagagatgagcgaggaagctttagctgactattgt
gagaggtattttcaaaatgaagattag

DBGET integrated database retrieval system