KEGG   Escherichia coli B REL606: ECB_01134Help
Entry
ECB_01134         CDS       T00944                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00020  Citrate cycle (TCA cycle)
ebr00480  Glutathione metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01120  Microbial metabolism in diverse environments
ebr01130  Biosynthesis of antibiotics
ebr01200  Carbon metabolism
ebr01210  2-Oxocarboxylic acid metabolism
ebr01230  Biosynthesis of amino acids
Module
ebr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECB_01134 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECB_01134 (icdA)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ECB_01134 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ACT38815
Structure
PDB: 

Position
1210492..1211742
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIKNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagttgttccggcacaaggcaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgaaaatccgattatcccttacattgaaggtgatggaatcggtgtagat
gtaaccccagccatgctgaaagtggtcgacgctgcagtcgagaaagcctataaaggcgag
cgtaaaatctcctggatggaaatttacaccggtgaaaaatccacacaggtttatggtcag
gacgtctggctgcctgctgaaactcttgatctgattcgtgaatatcgcgttgccattaaa
ggtccgctgaccactcctgttggtggcggtattcgctctctgaacgttgccctgcgccag
gaactggatctctacatctgcctgcgtccggtacgttactatcagggcactccaagcccg
gttaaacaccctgaactgaccgatatggttatcttccgtgaaaactcggaagacatttat
gcgggtatcgaatggaaagcagactctgccgacgccgagaaagtgattaaattcctgcgt
gaagagatgggggtgaagaaaattcgcttcccggaacattgtggtatcggtattaagccg
tgttcggaagaaggcaccaaacgtctggttcgtgcagcgatcgaatacgcaattgctaac
gatcgtgactctgtgactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagctggcgcgtgaagagtttggcggtgaactgatcgacggc
ggcccgtggctgaaagttaaaaacccgaacaccggcaaagagatcgtcattaaagacgtg
attgctgatgcattcctgcaacagatcctgctgcgtccggctgaatatgatgttatcgcc
tgtatgaacctgaacggtgactacatttctgacgctctggcagcgcaggttggcggtatc
ggtatcgcccctggagcaaacatcggtgacgaatgcgccctgtttgaagccacccacggt
actgcgccgaaatacgccggtcaggacaaagtaaaccctggctctattattctctccgct
gagatgatgttacgccatatgggctggactgaagccgcagacctgattgttaaaggtatg
gaaggcgcaatcaatgcgaagaccgtaacctatgacttcgagcgtctgatggaaggcgct
aaactgctgaaatgttcagaatttggtgatgcgatcatcaagaacatgtaa

DBGET integrated database retrieval system