KEGG   Escherichia coli B REL606: ECB_01680Help
Entry
ECB_01680         CDS       T00944                                 

Gene name
btuC
Definition
(GenBank) vtamin B12-transporter permease
  KO
K06073  vitamin B12 transport system permease protein
Organism
ebr  Escherichia coli B REL606
Pathway
ebr02010  ABC transporters
Module
ebr_M00241  Vitamin B12 transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECB_01680 (btuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebr02000]
    ECB_01680 (btuC)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter [MD:M00241] [OT]
    ECB_01680 (btuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: ACT39343
Structure
PDB: 

Position
complement(1771439..1772419)
Genome map
AA seq 326 aa AA seqDB search
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgacacttgcccgccaacaacagcgacaaaatattcgctggttattatgcctgtca
gttttgatgctgctggcgcttctcttaagcctttgcgccggtgaacaatggatctcgcca
ggtgactggtttactcctcgtggcgaactgttcgtctggcaaattcgcctgccacgtacg
ctggctgtattgctggttggtgcggcgctggctatatccggcgctgtaatgcaggcgttg
tttgaaaatcctctggcagaacctggactacttggcgtctctaacggcgcaggcgtgggg
cttatcgccgcggtattgcttgggcaagggcaactccccaactgggcgctagggctgtgt
gcgattgctggcgcgcttatcatcactttaatactcttacgtttcgcccgtcgtcatctt
tcgaccagtcggttattgctggctggcgttgcattagggattatctgtagcgcactaatg
acgtgggctatctacttttccacctcagttgatttgcgtcagctgatgtactggatgatg
ggcggttttggcggcgtagactggcggcaaagctggctgatgctggcattgatccccgtg
ttgttgtggatctgttgtcagtccaggccgatgaatatgttagcacttggcgagatctcg
gcgcggcaactgggtttacccctgtggttctggcgcaatgtgctggtggcagcgaccggc
tggatggttggcgtcagtgtggcgctggcgggtgctatcggctttattggtctggtgatc
ccccatattctccggttgtgtggtttaaccgatcatcgcgtattacttcccggctgcgcg
ctggcaggggcgagcgcattgctgctggccgatattgtagcgcgcctggcattagctgcc
gcagagctgcctattggcgtggtcaccgcaacgttaggtgcgccggtgtttatctggtta
ttgttaaaagcaggacgttag

DBGET integrated database retrieval system