KEGG   Escherichia coli B REL606: ECB_01682Help
Entry
ECB_01682         CDS       T00944                                 

Gene name
pheT
Definition
(GenBank) phenylalanyl-tRNA synthetase beta subunit
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00970  Aminoacyl-tRNA biosynthesis
Module
ebr_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECB_01682 (pheT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebr01007]
    ECB_01682 (pheT)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ebr03016]
    ECB_01682 (pheT)
Enzymes [BR:ebr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     ECB_01682 (pheT)
Amino acid related enzymes [BR:ebr01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   ECB_01682 (pheT)
Transfer RNA biogenesis [BR:ebr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECB_01682 (pheT)
 Prokaryotic Type
    ECB_01682 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B3_4 FDX-ACB tRNA_bind B5
Motif
Other DBs
NCBI-ProteinID: ACT39345
Structure
PDB: 

Position
complement(1772824..1775211)
Genome map
AA seq 795 aa AA seqDB search
MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD
KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC
SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA
VLNQLPLVQPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR
CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD
TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY
ERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHH
IADEQVTDILRRLGCEVTEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPVQ
ASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISVE
MSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPLGIRQDLMLAGVICGNR
YEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGERIG
FVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENVPA
ADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATVAK
CVEALKERFQASLRD
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtgaactgtggttacgcgaatgggtgaacccggcgattgatagcgatgcg
ctggcaaatcaaatcactatggcgggcctggaagttgacggtgtagaaccggttgccggc
agcttccacggcgtggtcgttggtgaagtggttgagtgtgcgcagcatccgaacgctgac
aaactgcgtgtgacaaaagtgaatgtcggcggcgatcgcctgctggacatcgtctgcggt
gcgccaaactgccgtcagggcctgcgtgtagcggtagcgaccattggtgctgttctgccg
ggtgatttcaaaattaaagcggcgaaactgcgtggcgaaccgtctgaagggatgctgtgc
tccttctctgaactgggcatttctgacgatcacagcggcattatcgaactgcctgcggat
gcgccgattggcaccgatatccgtgaatacctgaaacttgatgacaacaccatcgaaatc
agcgtgacgccaaaccgtgccgactgcttaggcatcattggtgttgcgcgtgacgttgcc
gtgctgaaccagctgccgctggttcaaccggaaatcgttccggttggtgcgaccatcgac
gacacgctgccgattacagtcgaagcgccggaagcctgcccgcgttatcttggccgtgtg
gtaaaaggcattaacgttaaagcgccaactccgctgtggatgaaagaaaaactgcgtcgt
tgcgggatccgttctatcgatgcagttgttgacgtcaccaactatgtgctgctcgaactg
ggccagccgatgcacgctttcgataaagatcgcattgaaggcggcattgtggtgcggatg
gcgaaagagggcgaaacgctggtgctgctcgacggtactgaagcgaagctgaatgctgac
actctggtcatcgccgaccacaacaaggcgctggcgatgggcggcatcttcggtggcgaa
cattctggcgtgaatgacgaaacacaaaacgtgctgctggaatgcgcgttctttagcccg
ctgtctatcaccggtcgtgctcgtcgtcatggcctgcataccgatgcgtctcaccgttat
gagcgtggcgttgatccggcactgcagcacaaagcgatggaacgtgcgacccgtctgctg
atcgacatctgcggtggtgaggctggcccggtaattgatatcaccaacgaagcaacgctg
ccgaagcgtgcaaccatcactctacgtcgtagcaaactggatcgcctgatcggccatcat
attgcggatgagcaggtaactgacattctgcgtcgtctcggctgcgaagtgaccgaaggc
aaagacgaatggcaggcagttgcgccgagctggcgtttcgatatggagattgaagaagat
ctggttgaagaagtcgcgcgtgtttacggctacaacaacatcccggatgagccggtacag
gcaagcctgattatgggtactcaccgtgaagctgacctgtcgctcaagcgcgtgaaaacg
ctgctcaacgacaaaggctatcaggaagtgatcacctacagcttcgttgatccgaaagtg
cagcagatgatccatccaggcgttgaagccttactgctgccaagcccgatctctgttgaa
atgtcagcaatgcgtctttctctgtggactggcctgctggcaaccgtggtgtacaaccag
aaccgtcagcagaaccgtgtgcgcattttcgaaagcggtctgcgtttcgtaccagatact
caggcaccgttgggcattcgtcaggatctgatgttagccggtgtgatttgcggtaaccgt
tacgaagagcactggaacctggcaaaagagaccgttgatttctatgatttgaaaggcgat
cttgaatccgttctcgacctgaccggtaaactgaatgaggttgagttccgtgcagaagcg
aatccggcactgcatccggggcaatccgcagcgatttatctgaaaggtgaacgtattggt
tttgttggggttgttcatcctgaactggaacgtaaactggatcttaacggtcgcactctg
gtgttcgaactggagtggaacaagctcgcagaccgcgtggtgcctcaggcgcgcgagatt
tctcgcttcccggcgaaccgtcgtgacatcgcggtggtggtcgcagaaaacgttcccgca
gcggatattttatccgaatgtaagaaagttggcgtaaatcaggtagttggcgtaaactta
tttgacgtgtaccgcggtaagggtgttgcggaggggtataagagcctcgccataagcctg
atcctgcaagataccagccgtacactcgaagaagaggagattgccgctaccgtcgccaaa
tgtgtagaggcattaaaagagcgattccaggcatcattgagggattga

DBGET integrated database retrieval system