KEGG   Escherichia coli B REL606: ECB_01702Help
Entry
ECB_01702         CDS       T00944                                 

Gene name
ydjC
Definition
(GenBank) hypothetical protein
  KO
K03478  chitin disaccharide deacetylase [EC:3.5.1.105]
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECB_01702 (ydjC)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.105  chitin disaccharide deacetylase
     ECB_01702 (ydjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdjC
Motif
Other DBs
NCBI-ProteinID: ACT39364
Position
complement(1793651..1794400)
Genome map
AA seq 249 aa AA seqDB search
MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGM
HFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELVSQYLRFIELFGRKPT
HLDSHHHVHMFPQIFPIVARFAAEQGIALRADRQMAFDLTVNLRTTQGFSSAFYGEEISE
SLFLQVLDDAGHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELDVLTSASLKGAIAQRG
YRLGSYRDV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttactgattgttaatgccgatgattttggcttaagcaaaggtcagaactac
ggcattatcgaggcctgtcgcaatgggattgtcacgtcgacgacggcgctggtgaatggg
caggctattgaccatgcggtgcagttgagtcgtgatgaaccgagtctggccatagggatg
cactttgtccttactatgggtaagccactgacagctatgccggggttaacccgcgatggt
gtgctgggaaaatggatctggcagttggcagaagaagatgctttaccgctggaagaaatt
actcaggagcttgtcagtcagtatttgcgtttcattgagctatttggacgcaaacctacg
catcttgatagccatcatcatgtgcatatgttcccgcagattttcccgattgttgccagg
tttgcggcagagcagggcattgcgttgcgggcggatcgtcagatggcgtttgatttgacg
gtcaacctgcgcactacccagggattcagcagtgcattctacggtgaagagatcagtgag
tcgctgttcctgcaagtgctggatgacgcaggccatcggggtgatcgttcgctggaggtg
atgtgtcatccggcgtttatcgataatactatccgtcagagtgcttactgtttcccacgc
ttaacggagctggatgtgttgacatcagcgtcgttgaaaggtgctatcgctcagcgtggt
tatcggttggggagttatcgggatgtgtaa

DBGET integrated database retrieval system