KEGG   Escherichia coli B REL606: ECB_01703Help
Entry
ECB_01703         CDS       T00944                                 

Gene name
celF
Definition
(GenBank) cryptic phospho-beta-glucosidase, NAD(P)-binding
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00010  Glycolysis / Gluconeogenesis
ebr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECB_01703 (celF)
   00500 Starch and sucrose metabolism
    ECB_01703 (celF)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECB_01703 (celF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACT39365
Position
complement(1794413..1795765)
Genome map
AA seq 450 aa AA seqDB search
MSQKLKVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGKAKLDIIFDLCQRMID
NAGVPMKLYKTLDRREALKDADFVTTQLRVGQLPARELDERIPLSHGYLGQETNGAGGLF
KGLRTIPVIFDIVKDVEELCPNAWVINFTNPAGMVTEAVYRHTGFKRFIGVCNIPIGMKM
FIRDVLMLKDSDDLSIDLFGLNHMVFIKDVLVNGKSRFAELLDGVASGQLKASSVKNIFD
LPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEYYKGGARAQVVQKVEKQLFELYKNP
ELKVKPKELEQRGGAYYSDAACEVINAIYNDKQAEHYVNIPHHGHIDNIPADWAVEMTCK
LGRDGATPHPRITHFDDKVMGLIHTIKGFEIAASNAALSGEFNDVLLALNLSPLVHSDRD
AELLAREMILAHEKWLPNFADCIAELKKAH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaaattaaaagtcgtcactattggtggcgggagcagctataccccggagtta
ctggaaggatttattaagcgttatcacgaattgccggtcagcgaattatggctggtggat
gtcgaaggtggtaaagcgaaactggatattattttcgatctctgccaacggatgattgat
aacgctggcgtcccgatgaagctttataaaacgctggatcgccgcgaagcattgaaagat
gctgatttcgttactacccaactgcgcgttggccaattaccggcgcgtgaactggatgaa
cgtattccattaagtcatggttatcttggtcaggaaaccaacggcgcgggcggtttgttt
aaaggtctgcgtaccattccggtgatttttgacatcgtaaaagatgtcgaagaactttgt
ccgaatgcatgggtgattaacttcactaacccggcgggaatggtcactgaagccgtttat
cgtcataccggatttaaacgctttatcggcgtgtgtaatattccgatcggcatgaagatg
tttattcgcgatgttctgatgctgaaagacagcgatgatttatctatcgatttgttcggc
ctcaaccatatggtgttcattaaggatgtgctggtaaatggcaagtcgcgctttgccgaa
ttgcttgatggtgtggcgtcagggcagttaaaagcgtcctctgtaaaaaatattttcgat
ctgccatttagtgagggcttaattcgttcgttgaatctgctgccatgttcttatctgctg
tattacttcaagcagaaagagatgctggctattgaaatgggcgaatactacaaaggcggc
gcacgagcgcaggtagtacagaaagtcgagaaacaactttttgagctgtataaaaacccg
gagttgaaagttaagccgaaagaactggaacagcgcggtggggcttattactctgatgca
gcgtgcgaagtgatcaacgctatctacaacgacaagcaagcagaacattacgttaatatc
ccgcatcatgggcatattgataatattccggcagactgggcggtagaaatgacctgtaag
ctggggcgcgatggcgcgacgccacatccgcgcattacgcatttcgatgataaagtgatg
gggctgattcacaccattaaaggcttcgagattgctgccagcaacgccgcacttagcgga
gaatttaacgatgtgttactggcgctaaaccttagtccgttggtgcattccgatcgcgat
gctgagctgctggcacgcgagatgattctggcgcacgagaaatggctgccaaactttgcc
gactgcatcgcagagcttaaaaaagcacattaa

DBGET integrated database retrieval system