KEGG   Escherichia coli B REL606: ECB_01704Help
Entry
ECB_01704         CDS       T00944                                 

Gene name
celD
Definition
(GenBank) DNA-binding transcriptional dual regulator
  KO
K03490  AraC family transcriptional regulator, dual regulator of chb operon
Organism
ebr  Escherichia coli B REL606
Brite
Transcription factors [BR:ebr03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    ECB_01704 (celD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AraC HTH_18 Cupin_2 AraC_binding Cupin_7 EutQ JmjC TRM13 Cupin_6 Cupin_3 AraC_binding_2
Motif
Other DBs
NCBI-ProteinID: ACT39366
Position
complement(1795870..1796712)
Genome map
AA seq 280 aa AA seqDB search
MMQPVINAPEIATAREQQLFNGKNFHVFIYNKTESISGLHQHDYYEFTLVLTGRYFQEIN
GKRVLLERGDFVFIPLGSHHQSFYEFGATRILNVGISKRFFEQHYLPLLPYCFVASQVYR
TNNAFLTYVETVISSLNFRETGLEEFVEMVTFYVINRLRHYREEQVIDDVPQWLKSTVEK
MHDKEQFSESALENMVALSAKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYS
VTDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRKKLTEFNR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagccagtgattaacgcgccggaaattgccactgcccgagaacagcagttgttt
aatggcaaaaacttccatgtgtttatctataacaaaactgagagtatcagcggactgcat
cagcacgactattatgaatttactctggtattaaccgggcgttatttccaggagattaac
ggtaagcgcgtgttactggaacggggcgattttgtttttattccgttaggttcgcaccat
caaagtttttatgagtttggtgccacgcgcatattgaacgttgggatcagtaaacgcttt
tttgagcagcattacctgccattgttgccttattgctttgtcgcttcgcaggtataccgg
accaataacgcttttctcacctatgtggaaacagtgatttcttcattgaatttccgcgaa
acagggctggaagagtttgttgagatggttactttttatgtcattaaccgtttacgtcat
taccgcgaagaacaggtgattgatgatgtaccgcagtggctgaaaagtacggtagaaaag
atgcatgataaagagcagtttagtgaatcggcgctggagaatatggtggcgttgtcagcc
aaatcacaggaatatttgacgcgagcgactcaacgatattatggcaaaacgccaatgcag
attattaatgaaatccgtattaattttgccaaaaaacaactggaaatgaccaactattca
gtgacggatattgcgtttgaggccggttatagtagcccgagtttgtttattaaaacgttt
aagaaattaacgtcctttacgcctaagagctatcgtaagaaattgactgaatttaatcgg
taa

DBGET integrated database retrieval system