KEGG   Escherichia coli B REL606: ECB_01706Help
Entry
ECB_01706         CDS       T00944                                 

Gene name
celB
Definition
(GenBank) N,N'-diacetylchitobiose-specific enzyme IIC component of PTS
  KO
K02761  PTS system, cellobiose-specific IIC component
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00500  Starch and sucrose metabolism
ebr02060  Phosphotransferase system (PTS)
Module
ebr_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECB_01706 (celB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECB_01706 (celB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebr02000]
    ECB_01706 (celB)
Transporters [BR:ebr02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    ECB_01706 (celB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC
Motif
Other DBs
NCBI-ProteinID: ACT39368
Position
complement(1797121..1798479)
Genome map
AA seq 452 aa AA seqDB search
MSNVIASLEKVLLPFAVKIGKQPHVNAIKNGFIRLMPLTLAGAMFVLINNVFLSFGEGSF
FYSLGIRLDASTIETLNGLKGIGGNVYNGTLGIMSLMAPFFIGMALAEERKVDALAAGLL
SVAAFMTVTPYSVGEAYAVGANWLGGANIISGIIIGLVVAEMFTFIVRRNWVIKLPDSVP
ASVSRSFSALIPGFIILSVMGIIAWALNTWGTNFHQIIMDTISTPLASLGSVVGWAYVIF
VPLLWFFGIHGALALTALDNGIMTPWALENIATYQQYGSVEAALAAGKTFHIWAKPMLDS
FIFLGGSGATLGLILAIFIASRRADYRQVAKLALPSGIFQINEPILFGLPIIMNPVMFIP
FVLVQPILAAITLAAYYMGIIPPVTNIAPWTMPTGLGAFFNTNGSVAALLVALFNLGIAT
LIYLPFVVVANKAQNAIDKEESEEDIANALKF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgttattgcatcgcttgaaaaggtactcctcccttttgcagttaaaatagga
aagcagccacacgttaatgcaatcaaaaatggctttattcgcttaatgccgttaaccctt
gcgggggccatgtttgtattaattaacaacgtttttctaagctttggggaggggtcgttt
ttttattccttaggtattcgcctggatgcctcaaccattgaaacacttaatggtctgaaa
ggtattggcggcaacgtatataacggaacattagggataatgtctttaatggcaccgttc
tttattggcatggcgctggcagaagagcgtaaagtcgatgcgctggcggctgggttgtta
tccgttgcagcatttatgaccgtcaccccatatagtgtcggtgaggcctatgcggttggc
gcaaactggttaggtggggcgaatatcatctccgggattattattggcctggtggtggca
gaaatgtttacctttattgtccgccgcaattgggtcattaaactgcccgacagcgtacct
gcttcagtatcgcgttccttctcggcattaattcccggctttattattctttccgtgatg
gggattattgcctgggcgttgaatacctggggcaccaacttccatcagatcattatggat
accatctcaactccactggcatcgttgggtagcgtggtgggctgggcctatgtgatcttt
gttccactgctctggttcttcggtattcatggcgcgctggcgctgaccgcactggacaac
ggcattatgacgccgtgggcactggaaaatatcgcgacctatcagcaatatggttccgtc
gaagcggcgctggcagccggtaagaccttccatatctgggccaagccgatgctggactcc
tttattttccttgggggcagtggtgcgactttaggcctgatcctggctatctttatcgcc
tctcgccgtgctgattatcgtcaggtggcaaaactggcgctgccgtccggcatcttccag
attaacgaaccgattctgtttggtctgccaattatcatgaacccggtgatgtttatcccg
tttgtactggtacaaccgattctggcggcaatcaccctcgcagcgtactacatgggcatt
attcctccggtgaccaatattgcaccgtggaccatgccaaccggtctgggagccttcttt
aacaccaacggtagcgtcgccgcattgctggtcgcactcttcaaccttggcatcgcaacg
ttaatttatctgccctttgttgtggtggctaacaaagcacaaaatgcgattgataaagaa
gagagcgaagaagatatcgctaacgccctgaaattttaa

DBGET integrated database retrieval system