KEGG   Escherichia coli B REL606: ECB_01710Help
Entry
ECB_01710         CDS       T00944                                 

Gene name
ydjQ
Definition
(GenBank) endonuclease of nucleotide excision repair
  KO
K05984  excinuclease Cho [EC:3.1.25.-]
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ebr03400]
    ECB_01710 (ydjQ)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.25  Site-specific endodeoxyribonucleases that are specific for altered bases
    3.1.25.-  
     ECB_01710 (ydjQ)
DNA repair and recombination proteins [BR:ebr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     ECB_01710 (ydjQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG
Motif
Other DBs
NCBI-ProteinID: ACT39372
Position
1800780..1801667
Genome map
AA seq 295 aa AA seqDB search
MVRRLTSPRLEFEAAAIYEYPEHLRSFLNDLPTRPGVYLFHGESDTMPLYIGKSVNIRSR
VLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNKRLRRNRQLCALQ
LNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQTIADEQKLCYGLLGLEPLSRGRA
CFRSALKRCAGACCGKESHEEHALRLRQSLERLRVVCWPWQGAVALKEQHPEMTQYHIIQ
NWLWLGAVNSLEEATTLIRTPAGFDHDGYKILCKPLLSGNYEITELDPANDQRAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggtacggcgtttaacttctccgcggctcgaatttgaagctgcggcaatttatgaatat
cccgaacatttacgttcattccttaatgacttacccacccgaccaggggtgtatctgttt
catggcgaaagtgacaccatgccgctctatatcggcaaaagcgttaatatccgcagtcgg
gtgctttctcatttacgcaccccggatgaagccgccatgctacggcaatcccgacggatc
agctggatatgtaccgccggtgaaatcggcgctctgctccttgaagcgcgattaatcaaa
gaacaacagccgctgtttaataaacggttgcgccgcaatcgccagctctgtgccctgcaa
ttaaatgaaaagcgcgtcgatgtggtgtatgccaaagaggtggatttttcacgagccccc
aacctgtttggcctgtttgccaataggcgcgcagctttgcaagcattgcagaccatcgct
gatgaacaaaaactttgttatggcctgctgggactggaaccgttaagtcgcggtcgtgca
tgttttcgttcagcgctaaaacgttgcgccggagcatgctgcggtaaagagagccatgag
gaacatgcgctacgcttgcgccagtctctggagcgtttgcgggtggtgtgttggccttgg
caaggggcggtggcgctgaaagaacagcacccggaaatgactcaatatcatattattcaa
aactggctgtggctgggggcggttaattcgctggaagaagcgacaacgttaattcggaca
cccgccgggtttgatcacgacggttataaaattctttgtaagccgctgctttccggtaac
tatgaaattactgaacttgatccggcgaatgaccagcgagccagttga

DBGET integrated database retrieval system