KEGG   Escherichia coli B REL606: ECB_01712Help
Entry
ECB_01712         CDS       T00944                                 

Gene name
spy
Definition
(GenBank) envelope stress induced periplasmic protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LTXXQ Metal_resist DUF4890 Rota_VP2 CPDase DUF2570
Motif
Other DBs
NCBI-ProteinID: ACT39374
Structure
PDB: 

Position
complement(1802405..1802890)
Genome map
AA seq 161 aa AA seqDB search
MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDA
QKQQIREIMKGQRDQMKRPPLEERRAMHDIITSDTFDKVKAEAQIAKMEEQRKANMLAHM
ETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattaactgcactgtttgttgcctctaccctggctcttggcgcggctaacctg
gcccatgccgcagacaccactaccgcagcaccggctgacgcgaagccgatgatgcaccac
aaaggcaagttcggtccgcatcaggacatgatgttcaaagacctgaacctgaccgacgcg
cagaaacagcagatccgcgaaatcatgaaaggccagcgtgaccagatgaaacgtccgccg
ctggaagaacgccgcgcaatgcatgacatcattaccagcgataccttcgataaagtaaaa
gctgaagcgcagatcgcaaaaatggaagaacagcgcaaagctaacatgctggcgcacatg
gaaacccagaacaaaatttacaacatcctgacgccggaacagaaaaagcaatttaatgct
aattttgagaagcgtctgacagaacgtccagcggcaaaaggtaaaatgcctgcaactgct
gaataa

DBGET integrated database retrieval system