KEGG   Escherichia coli B REL606: ECB_01716Help
Entry
ECB_01716         CDS       T00944                                 

Gene name
astA
Definition
(GenBank) arginine succinyltransferase
  KO
K00673  arginine N-succinyltransferase [EC:2.3.1.109]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00330  Arginine and proline metabolism
ebr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ECB_01716 (astA)
Enzymes [BR:ebr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.109  arginine N-succinyltransferase
     ECB_01716 (astA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AstA
Motif
Other DBs
NCBI-ProteinID: ACT39378
Position
complement(1806996..1808030)
Genome map
AA seq 344 aa AA seqDB search
MMVIRPVERSDVSALMQLASKTGGGLTSLPANEATLSARIERAIKTWQGELPKSEQGYVF
VLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSS
ELCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEMRGVIDEHGYSPFWQSLG
KRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQDVIGQVHPQTAPARAVLE
KEGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAQGDFPACLVANENYHHF
RVVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRLCAEEKTA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcatccgtcccgttgagcgatcagatgtctcggcgctgatgcagcttgccagc
aaaacgggcggcggcctgacgtcgcttcccgccaatgaagccacgctttcggcgcgtatc
gaaagggcaatcaaaacctggcaaggcgaactgcccaaaagtgagcagggctatgtgttc
gtgctggaagatagcgagacaggcaccgtggcggggatttgtgccattgaggtggcggtt
gggctgaacgatccctggtacaactatcgcgtcggcacgttggttcacgcctcaaaagag
ctgaatgtctataacgcattgccgacgctgtttctcagtaacgatcacaccggcagcagc
gagctgtgcacgctgtttctcgacccggactggcgcaaagagggcaacggctatttgctg
tcgaaatcgcgctttatgtttatggcggcttttcgcgacaagtttaatgacaaagtggtt
gctgaaatgcgcggggtgattgacgaacacggctattcaccgttctggcaaagcctcggt
aaacgcttcttttcgatggattttagccgcgccgattttctctgcggcaccgggcaaaag
gcatttattgcagaactgatgccgaaacatccgatctatacccactttttatcccaggaa
gcccaggacgtcatcggtcaggtacatccgcaaaccgcgcctgcccgcgcggtgctggag
aaagaaggttttcgttaccgcaactatatcgacatcttcgacggcgggccaacgcttgag
tgtgacatcgaccgcgtgcgcgccatccgtaaaagtcggctggtggaagtggcagaaggg
cagcctgcgcagggcgattttccggcctgcctggtcgccaatgaaaattatcaccatttc
cgcgtggtgctggtgcgtaccgatccggcaaccgagcgtttgatattaaccgccgcacaa
ctggatgccctgaaatgccacgccggggatcgcgttcgtctggtgcgcctgtgcgcagag
gagaaaacagcatga

DBGET integrated database retrieval system