KEGG   Escherichia coli B REL606: ECB_01717Help
Entry
ECB_01717         CDS       T00944                                 

Gene name
astC
Definition
(GenBank) succinylornithine transaminase, PLP-dependent
  KO
K00840  succinylornithine aminotransferase [EC:2.6.1.81]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00330  Arginine and proline metabolism
ebr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ECB_01717 (astC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebr01007]
    ECB_01717 (astC)
Enzymes [BR:ebr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.81  succinylornithine transaminase
     ECB_01717 (astC)
Amino acid related enzymes [BR:ebr01007]
 Aminotransferase (transaminase)
  Class III
   ECB_01717 (astC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACT39379
Structure
PDB: 

Position
complement(1808027..1809247)
Genome map
AA seq 406 aa AA seqDB search
MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPEL
REALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFA
HDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALI
DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH
YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELIN
TPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAK
AGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSRGSS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccaattacgcgtgaaaactttgatgaatggatgatacctgtttacgcttcg
gcaccctttataccggtacgtggcgaaggttcgcgcttgtgggatcagcaggggaaagag
tatatcgactttgcgggtggcattgcggtgaacgcgctgggccatgcgcatccggaactg
cgtgaagcgctgaacgaacaggcgagtaagttctggcataccggcaacggttacaccaac
gagccggtactgcgactggcgaaaaaattgatcgacgccacgtttgccgatcgcgtcttc
ttttgtaactccggtgcggaagccaacgaagcggcgctaaaactggcgcgtaaattcgct
cacgaccgctacggcagccataagagcggcatcgtggcgttcaaaaatgcgtttcatggt
cgcacgctgtttactgtcagtgcgggtgggcagccagcctattcacaggattttgcgcca
ctgccggcggatattcgtcatgctgcatataacgatattaactctgccagcgcgctgatt
gacgactctacctgtgcggtgattgtcgaacccatccagggggaaggtggtgtggtgcca
gccagcaacgcgtttttacaaggtctgcgtgaattgtgtaaccgccacaatgcgctgttg
atttttgatgaagtacaaaccggcgtcgggcgcaccggggaactgtatgcctatatgcac
tacggcgtgacgcctgatctgttaactaccgccaaagcgctgggcggcggtttcccggtc
ggtgcgttgttggcaaccgaagagtgcgcccgcgtgatgaccgttggcactcatggcacc
acctatggcggtaatccgctggcctcggcggtggcaggcaaagtgctggagctcatcaac
acaccagagatgcttaatggcgttaaacagcgtcacgactggtttgttgagcgtcttaat
actattaatcaccgctatggtttgttcagtgaagttcgcggcttaggtttgctgattggc
tgtgtactgaatgccgattacgccgggcaagcgaaacagatctctcaggaagcggcgaaa
gcaggcgtgatggtactgattgcgggtggcaacgtggtgcgttttgcgcctgcgctcaat
gtcagcgaagaagaggtgacgaccggactggatcgctttgcagctgcttgcgaacacttt
gttagccgaggttcatcatga

DBGET integrated database retrieval system