KEGG   Escherichia coli B REL606: ECB_01725Help
Entry
ECB_01725         CDS       T00944                                 

Gene name
ynjD
Definition
(GenBank) predicted transporter subunit: ATP-binding component of ABC superfamily
  KO
K05779  putative thiamine transport system ATP-binding protein
Organism
ebr  Escherichia coli B REL606
Module
ebr_M00192  Putative thiamine transport system
Brite
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    ECB_01725 (ynjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_25 AAA_29 AAA_16 RsgA_GTPase SbcCD_C AAA_22 RNA_helicase NACHT AAA_33 AAA_23 Rad17 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACT39386
Position
1815975..1816628
Genome map
AA seq 217 aa AA seqDB search
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGE
LWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALER
SGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEV
RALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgtgaaaaatgtttcgctacgtttaccagaaagccgcttgctgacaaacgtt
aactttacggtggataaaggtgacattgtcacgttaatggggccgtctggctgtggaaaa
tccactctgttttcatggatgattggtgcactggccgaacagttttcttgtacaggtgag
ctatggctcaatgagcaacggattgacatcctacccaccgcacagcgtcagattggcatt
ctttttcaggatgcactgttatttgaccagttcagtgtcgggcaaaatttactgctggcg
ctaccggcgacacttaaagggaatgcccgacgtaatgccgtgaatgatgcacttgagcgt
tcaggccttgagggagctttccatcaggatcctgccactttgtctggcggtcagcgagcg
cgcgttgctctactacgcgcccttctcgcccaaccaaaagcgttactcctggatgagcca
ttcagccgtcttgatgtggctctgcgcgataattttcgccagtgggtgttcagcgaagtt
cgcgccctggcgatccccgtcgttcaggtaacgcacgatctccaggatgttcctgctgat
agttctgttctggatatggcgcagtggtcagaaaattacaacaaactgcgataa

DBGET integrated database retrieval system