KEGG   Escherichia coli B REL606: ECB_01733Help
Entry
ECB_01733         CDS       T00944                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00450  Selenocompound metabolism
ebr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECB_01733 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ebr03016]
    ECB_01733 (selD)
Enzymes [BR:ebr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     ECB_01733 (selD)
Transfer RNA biogenesis [BR:ebr03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ECB_01733 (selD)
 Prokaryotic Type
    ECB_01733 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ACT39394
Structure
PDB: 

Position
complement(1824193..1825236)
Genome map
AA seq 347 aa AA seqDB search
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPDHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggagctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgaaacccgtgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatcttcgcgatggggggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtgaccgaaggtggacgctatgcatgtcgtcaggcgggtattgcgctggctggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggatcggcgttcttaccacggctgagaaaaaatcactgttgaaaccagaccatcaggga
ctggcgacggaagtgatgtgccggatgaacatcgcaggcgcgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttacgggctttggtctgctgggccacttgagcgaaatg
tgtcagggggctggtgtgcaggcacgcgtcgactatgaagcgatcccgaaactccccggt
gttgaagagtacattaagttgggcgcagtacctggcggcactgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggtcaaagctaca
gccgccgagtttggcattgaactgacggcaattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagattcgttaa

DBGET integrated database retrieval system