KEGG   Escherichia coli B REL606: ECB_01736Help
Entry
ECB_01736         CDS       T00944                                 

Gene name
ansA
Definition
(GenBank) cytoplasmic asparaginase I
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00250  Alanine, aspartate and glutamate metabolism
ebr00460  Cyanoamino acid metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECB_01736 (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ECB_01736 (ansA)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     ECB_01736 (ansA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase
Motif
Other DBs
NCBI-ProteinID: ACT39397
Structure
PDB: 

Position
1828088..1829104
Genome map
AA seq 338 aa AA seqDB search
MQKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDS
SDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIP
LAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPL
LEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILR
SYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADM
TVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTPDD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaatcaatttacgttgcctacacgggcgggaccatcgggatgcagcgttcc
gagcagggttatataccggtgtcaggtcatctacaacgccaactggcgctgatgccggaa
ttccatcgcccggagatgccagatttcaccattcatgaatatacgccgctgatggattct
tcagatatgacgccggaagactggcagcatattgctgaagatattaaagcgcactatgac
gactatgatggttttgtcattctgcacggcaccgacacgatggcgtataccgcctctgcg
ctgtcgttcatgctcgagaatctcggtaaaccggtcattgtgacagggtcacaaatcccg
ctggctgagttacgctctgacggacaaattaatctgctgaatgcgttgtacgttgcggcg
aattatccgatcaatgaagtaacgctctttttcaataaccgattgtatcgcggcaaccgc
actaccaaagcccatgccgatggttttgatgcgtttgcctctccaaaccttcctccgtta
ctggaagcaggtatccatattcgtcgtttgaatacgccacccgccccgcacggtgaaggg
gaattaatcgttcatccaatcaccccacaaccaattggcgtagtgacgatttatccaggg
atttctgctgacgtcgtgcgcaattttctgcgccaaccggtgaaagcattgattctgcgc
tcctatggcgtgggtaatgcgccacaaaacaaagccttcctgcaggaattacaagaagcc
agcgatcgcggtattgtggtggtcaacctgacacaatgtatgtccggtaaagtgaacatg
ggtggttatgccaccggtaacgccctcgcccatgccggcgtaattggcggtgcagatatg
actgtagaagccacgctaaccaaactgcattacctgcttagccaggaactggatactgaa
accattcgcaaggccatgagccaaaacctgcgcggcgaactgacgccggatgattaa

DBGET integrated database retrieval system