KEGG   Escherichia coli B REL606: ECB_01739Help
Entry
ECB_01739         CDS       T00944                                 

Gene name
ydjF
Definition
(GenBank) predicted DNA-binding transcriptional regulator
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 DUF4423 GntR HTH_20 HTH_5 HTH_12 FeoC HTH_Crp_2 DDRGK MarR Glyco_hydro_67N
Motif
Other DBs
NCBI-ProteinID: ACT39400
Position
complement(1831325..1832083)
Genome map
AA seq 252 aa AA seqDB search
MAAKDRIQAIKQMVANDKKVTVSNLSGIFQVTEETIRRDLEKLEDEGFLTRTYGGAVLNT
AMLTENIHFYKRASSFYEEKQLIARKALPFIDNKTTMAADSSSTVMELLKLLQDRSDLTL
LTNSAEAIHVLAQSEIKVVSTGGELNKNTLSLQGRITKEIISRYHVDIMVMSCKGLDINS
GALDSNEAEAEIKKTMIRQATEVALLVDHSKFDRKAFVQLADFSHINYIITDKSPGAEWI
AFCKDNNIQLVW
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcaaaagacaggattcaggcaattaagcaaatggttgccaacgataaaaaggtg
acagtctcaaatttgagtgggatttttcaggtaaccgaagaaaccattcgccgcgatctt
gagaagctggaagatgaaggctttttgaccagaacctatggtggtgctgttttaaataca
gcgatgttgacggagaatatccatttttataagcgcgcttcatcgttttatgaagagaag
cagcttattgcacgcaaggcactaccctttatcgacaataaaaccaccatggcagccgat
tccagtagtaccgtaatggaattgctcaaattgttacaggaccgtagtgacctgacgttg
ctaaccaactcggcggaagcgattcatgttctggctcagtcagaaattaaagtcgtttca
acgggtggggaactaaacaaaaatacactttccctgcaaggaagaattactaaagagatc
atcagccgctaccatgtcgatatcatggtaatgagttgtaaaggtcttgatattaacagc
ggcgcgctggactctaatgaagcggaagctgaaatcaaaaagacaatgatccgtcaggcg
acagaagttgcgttattggttgatcactctaagtttgatcgcaaagcttttgtccagtta
gccgactttagtcatattaattacataataactgataaatcaccgggtgcagagtggata
gcattttgcaaagacaataatatccagctggtgtggtaa

DBGET integrated database retrieval system