KEGG   Escherichia coli B REL606: ECB_01762Help
Entry
ECB_01762         CDS       T00944                                 

Gene name
yoaF
Definition
(GenBank) conserved outer membrane protein
  KO
K09712  uncharacterized protein
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECB_01762 (yoaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF333
Motif
Other DBs
NCBI-ProteinID: ACT39423
Position
complement(1854507..1854761)
Genome map
AA seq 84 aa AA seqDB search
MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVSTAQGVSNN
CKLPGGETIDEWALWRRDHPAGEK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcagttttgttctgccttgcttgctggtcctggctggttgttcaacccct
tctcagccagaagcacctaaaccgccgcagattggtatggcaaatccggcgtcggtctat
tgccagcagaagggcgggacgctcattccagtgtcgacagcgcaaggggtcagcaacaat
tgcaaattaccgggcggtgaaacgattgatgaatgggcattgtggcgacgggaccatccg
gctggtgaaaaataa

DBGET integrated database retrieval system