KEGG   Escherichia coli B REL606: ECB_01763Help
Entry
ECB_01763         CDS       T00944                                 

Gene name
yeaP
Definition
(GenBank) predicted diguanylate cyclase
  KO
K13069  diguanylate cyclase [EC:2.7.7.65]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     ECB_01763 (yeaP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF GAF_2 GAF_3 GAF Autoind_bind
Motif
Other DBs
NCBI-ProteinID: ACT39424
Position
1854944..1855969
Genome map
AA seq 341 aa AA seqDB search
MSDQIIARVSQSLAKEQSLESLVRQLLEMLEMVTDMESTYLTKVDVEARLQHIMFARNSQ
KMHIPENFTVSWDYSLCKRAIDENCFFSDEVPDRWGDCIAARNLGITTFLSTPIHLPDGS
FYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYIQKEALVEQLREANAALIAQSYTDSLT
GLPNRRAIFENLTTLFSLARHLNHKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLN
TLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIRGEYHLGDVDLYYPGASLGI
VEVDPETTDADSALHAVDIAMYQEKKHKQKTPFVAHPALHS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagatcagattatcgcccgcgtctcgcaatcccttgccaaagaacagtcactggaa
agtctggtccgacagcttctggagatgctggaaatggtcactgatatggaatcaacctac
ctgaccaaagtggatgtcgaagcgcgcctgcagcatattatgtttgcccgtaacagccag
aaaatgcacatcccggagaattttaccgtctcgtgggattactcgttatgcaaacgcgcc
attgatgaaaactgctttttcagcgatgaagtccctgaccgttggggcgactgtattgcg
gcacgcaatcttggcatcaccacatttctgagcacgccaattcacttaccggatggatca
ttctatggcacgctttgcgccgccagcagtgagaagcgccagtggagtgaacgcgcggaa
caggttttacagttattcgccggactgattgcacaatatattcaaaaagaggcactggtt
gaacagctgcgcgaagccaatgctgcgctgattgcgcaatcgtataccgactcgttaacc
gggctaccgaatcggcgggcgatttttgaaaatctgacgacgctgttttccctcgcccgg
catcttaaccataagataatgatcgcgtttatcgatctggataacttcaaattaatcaat
gatcgttttggtcataatagtggcgatctgtttctcattcaggttggcgagcgccttaat
acgctccagcaaaatggcgaagttattggtcgtctcggtggtgatgagtttttggttgtt
tcactaaacaacgagaatgcggatatttcgtcgctgcgagaacgtattcaacagcaaata
cgtggagaatatcacttaggtgatgttgatttgtattatcccggtgccagtcttggcata
gtagaagtcgatcctgaaacaaccgatgcagacagtgccctgcatgctgtcgatattgcg
atgtatcaggagaaaaaacacaaacagaaaacaccttttgtcgcgcatccagcgctacat
tcctga

DBGET integrated database retrieval system