KEGG   Escherichia coli B REL606: ECB_01764Help
Entry
ECB_01764         CDS       T00944                                 

Gene name
yeaQ
Definition
(GenBank) conserved inner membrane protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly_assoc Baculo_gp64 DUF2632 DUF2306
Motif
Other DBs
NCBI-ProteinID: ACT39425
Position
complement(1856236..1856484)
Genome map
AA seq 82 aa AA seqDB search
MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF
GSFVVAVIGAIVVLFIYRKIKS
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggcattctgtcatggattatttttgggcttattgccggtattctggcgaagtggatc
atgccaggtaaagatggtggtggattctttatgactatcctgctggggatagtcggtgct
gtagtcggcggatggatcagcacgctgtttggctttggtaaagtcgatggcttcaatttt
ggcagcttcgtggttgccgttattggtgcgattgtcgtgctatttatctacaggaagatt
aaaagttaa

DBGET integrated database retrieval system