KEGG   Escherichia coli B REL606: ECB_01766Help
Entry
ECB_01766         CDS       T00944                                 

Gene name
yeaR
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1971 Cupin_2 DUF386 AbiEii
Motif
Other DBs
NCBI-ProteinID: ACT39427
Structure
PDB: 

Position
complement(1856818..1857042)
Genome map
AA seq 74 aa AA seqDB search
MHGAVKYFGYPDEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVL
MEGAQQRKVIHNGK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgcatggggcggtcaaatatttcggctaccctgatgaacacagtgcagagcctgatcag
gtgatccttatcgaagcggggcagtttgcggtgttccctccagaaaagtggcacaacatt
gaagccatgactgacgatacttatttcaacattgacttcttcgtggctcctgaagtcctg
atggaaggtgcgcaacaacggaaagtcattcataacgggaaatga

DBGET integrated database retrieval system