KEGG   Escherichia coli B REL606: ECB_01767Help
Entry
ECB_01767         CDS       T00944                                 

Gene name
insL-4
Definition
(GenBank) putative transposase insL for insertion sequence IS186
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ACT39428
Position
1857121..1858233
Genome map
AA seq 370 aa AA seqDB search
MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLRLGLAYGPGGMSLREV
TAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTGCTSGKRLRLVDGTAIS
APGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECI
RSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGA
PFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQ
VADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFLIDDIIQPSLDFP
PRSAGSEKKN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaattactctcacgataactggtcagcaattctggcccatattggtaagcccgaagaa
ctggatacttcggcacgtaatgccggggctctaacccgccgccgcgaaattcgtgatgct
gcaactctgctacgtctggggctggcttacggccccggggggatgtcattacgtgaagtc
actgcatgggctcagctccatgacgttgcaacattatctgacgtggctctcctgaagcgg
ctgcggaatgccgccgactggtttggcatacttgccgcacaaacacttgctgtacgcgcc
gcagttacgggttgtacaagcggaaagagattgcgtcttgtcgatggaacagcaatcagt
gcgcccgggggcggcagcgctgaatggcgactacatatgggatatgatcctcatacctgt
cagttcactgattttgagctaaccgacagcagagacgctgaacggctggaccgatttgcg
caaacggcagacgagatacgcattgctgaccggggattcggttcgcgtcccgaatgtatc
cgctcacttgcttttggagaagctgattatatcgtccgggttcactggcgaggattgcgc
tggttaactgcagaaggaatgcgctttgacatgatgggttttctgcgcgggctggattgc
ggtaagaacggtgaaaccactgtaatgataggcaattcaggtaataaaaaagccggagct
ccctttccggcacgtctcattgccgtatcacttcctcccgaaaaagcattaatcagtaaa
acccgactgctcagcgagaatcgtcgaaaaggacgagtagttcaggcggaaacgctggaa
gcagcgggccatgtgctattgctaacatcattaccggaagatgaatattcagcagagcaa
gtggctgattgttaccgtctgcgatggcaaattgaactggcttttaagcggctcaaaagt
ttgctgcacctggatgctttgcgtgcaaaggaacctgaactcgcgaaagcgtggatattt
gctaatctactcgccgcatttttaattgacgacataatccagccatcgctggatttcccc
cccagaagtgccggatccgaaaagaagaactaa

DBGET integrated database retrieval system