KEGG   Escherichia coli B REL606: ECB_01775Help
Entry
ECB_01775         CDS       T00944                                 

Gene name
fadD
Definition
(GenBank) acyl-CoA synthase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00061  Fatty acid biosynthesis
ebr00071  Fatty acid degradation
ebr01100  Metabolic pathways
ebr01212  Fatty acid metabolism
ebr02024  Quorum sensing
Module
ebr_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ECB_01775 (fadD)
   00071 Fatty acid degradation
    ECB_01775 (fadD)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ECB_01775 (fadD)
Enzymes [BR:ebr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     ECB_01775 (fadD)
Lipid biosynthesis proteins [BR:ebr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   ECB_01775 (fadD)
Exosome [BR:ebr04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   ECB_01775 (fadD)
  Exosomal proteins of breast cancer cells
   ECB_01775 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ACT39436
Position
complement(1866639..1868324)
Genome map
AA seq 561 aa AA seqDB search
MKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVARYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVDKTAVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNA
TYGPLLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAITGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ
RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV
QEVAAVGVPSGSSGEAVKIFVVKKDPSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSN
VGKILRRELRDEARGKVDNKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaggtttggcttaaccgttatcccgcggacgttccgacggagatcaaccctgac
cgttatcaatctctggtagatatgtttgagcagtcggtcgcgcgctacgccgatcaacct
gcgtttgtgaatatgggggaggtaatgaccttccgcaagctggaagaacgcagtcgcgcg
tttgccgcttatttgcaacaagggttggggctgaagaaaggcgatcgcgttgcgttgatg
atgcctaatttattgcaatatccggtggcgctgtttggcattttgcgtgccgggatgatc
gtcgtaaacgttaacccgttgtataccccgcgtgagcttgagcatcagcttaacgatagc
ggcgcatcggcgattgttatcgtgtctaactttgctcacacactggaaaaagtggttgat
aaaaccgccgttcagcacgtaattctgacccgtatgggcgatcagctatctacggcaaaa
ggcacggtagtcaatttcgttgttaaatacatcaagcgtttggtgccgaaataccatctg
ccagatgccatttcatttcgtagcgcactgcataacggctaccggatgcagtacgtcaaa
cccgaactggtgccggaagatttagcttttctgcaatacaccggcggcaccactggtgtg
gcgaaaggcgcgatgctgactcaccgcaatatgctggcgaacctggaacaggttaacgcg
acctatggtccgctgttgcatccgggcaaagagctggtggtgacggcgctgccgctgtat
cacatttttgccctgaccattaactgcctgctgtttatcgaactgggtgggcagaacctg
cttatcactaacccgcgcgatattccagggttggtaaaagagttagcgaaatatccgttt
accgctatcacgggcgttaacaccttgttcaatgcgttgctgaacaataaagagttccag
cagctggatttctccagtctgcatctttccgcaggcggagggatgccagtgcagcaagtg
gtggcagagcgttgggtgaaactgacaggacagtatctgctggaaggctatggccttacc
gagtgtgcgccgctggtcagcgttaacccatatgatattgattatcatagtggtagcatc
ggtttgccggtgccgtcgacggaagccaaactggtggatgatgatgataatgaagtacca
ccgggtcaaccgggtgagctttgtgtcaaaggaccgcaggtgatgctgggttactggcag
cgtccggatgctacagatgagatcatcaaaaatggctggttacacaccggcgacatcgcg
gtgatggatgaagaagggttcctgcgcattgtcgatcgtaaaaaagacatgattctggtt
tccggttttaacgtctatcccaacgagattgaagatgtcgtcatgcagcatcctggcgta
caggaagtcgcggctgttggcgtaccttccggctccagtggtgaagcggtgaaaatcttc
gtagtgaaaaaagatccatcgcttaccgaagagtcactggtgaccttttgccgccgtcag
ctcacgggctacaaagtaccgaagctggtggagtttcgtgatgagttaccgaaatctaac
gtcggaaaaattttgcgacgagaattacgtgacgaagcgcgcggcaaagtggacaataaa
gcctga

DBGET integrated database retrieval system