KEGG   Escherichia coli B REL606: ECB_01776Help
Entry
ECB_01776         CDS       T00944                                 

Gene name
yeaY
Definition
(GenBank) predicted lipoprotein
  KO
K07285  outer membrane lipoprotein
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    ECB_01776 (yeaY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Slp
Motif
Other DBs
NCBI-ProteinID: ACT39437
Position
complement(1868529..1869110)
Genome map
AA seq 193 aa AA seqDB search
MAVQKNVIKGILAGTFALMLSGCVTVPDAIKGSSPTPQQDLVRVMSAPQLYVGQEARFGG
KVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYVDVNGFLDPVDFRGQLVTVVGP
ITGAVDGKIGNTPYKFMVMQVTGYKRWHLTQQVIMPPQPIDPWFYGGRGWPYGYGGWGWY
NPGPARVQTVVTE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcaaaagaatgttatcaaaggcatactggcaggtacgtttgcgctaatgctg
agcggttgtgtcactgtgccggacgccattaaaggcagcagtcccacgccgcaacaagat
ttagttcgggtgatgagtgcgccgcagctgtacgttggtcaggaggcacgctttggtggc
aaagtggttgcggtacaaaaccagcaagggaaaacccgcctggaaattgctaccgtaccg
ctggacagcggagccagaccgacgctgggagaaccttctcgcggtcgcatttatgtcgat
gtgaacggttttctggacccggtggatttccgtggacaacttgttacggtagtcgggcca
atcactggtgcggttgacggcaaaatcggcaatacgccctataaatttatggtgatgcaa
gtaacgggttacaaacgttggcatttaacccagcaggtgattatgccgcctcagccgatt
gatccatggttttatggcggtcgtggctggccctatggctacggcggatggggctggtat
aatcccggccccgcgagagtacaaacagttgtaactgaataa

DBGET integrated database retrieval system