KEGG   Escherichia coli B REL606: ECB_01784Help
Entry
ECB_01784         CDS       T00944                                 

Gene name
sdaA
Definition
(GenBank) L-serine deaminase I
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00260  Glycine, serine and threonine metabolism
ebr00270  Cysteine and methionine metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01130  Biosynthesis of antibiotics
ebr01200  Carbon metabolism
ebr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECB_01784 (sdaA)
   00270 Cysteine and methionine metabolism
    ECB_01784 (sdaA)
Enzymes [BR:ebr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     ECB_01784 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: ACT39445
Position
1875511..1876875
Genome map
AA seq 454 aa AA seqDB search
MISLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDSVTRVAVDVYGSLSLTGKGH
HTDIAIIMGLAGNEPATVDIDSIPGFIRDVEERERLLLAQGRHEVDFPRDNGMRFHNGNL
PLHENGMQIHAYNGDEVVYSKTYYSIGGGFIVDEEHFGQDAANEVSVPYPFKSATELLAY
CNETGYSLSGLAMQNELALHSKKEIDEYFAHVWQTMQACIDRGMNTEGVLPGPLRVPRRA
SALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYY
DHFIESVSPDIYTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGG
SPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALRRTSAPRVS
LDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtctattcgacatgtttaaggtggggattggtccctcatcttcccataccgta
gggcctatgaaggcgggtaaacagttcgtcgatgatctggtcgaaaaaggcttactggat
agcgttactcgcgttgccgtggacgtttatggttcactgtcgctgacgggtaaaggccac
cacaccgatatcgccattattatgggtcttgcaggtaacgaacctgccaccgtggatatc
gacagtattcccggttttattcgcgacgtagaagagcgcgaacgtctgctgctggcacag
ggacggcatgaagtggatttcccgcgcgacaacgggatgcgttttcataacggcaacctg
ccgctgcatgaaaacggtatgcaaatccacgcctataacggcgatgaagtcgtctacagc
aaaacttattattccatcggcggcggttttatcgtcgatgaagaacactttggtcaggat
gctgccaacgaagtgagcgtgccgtatccgttcaaatctgccaccgaactgctcgcgtac
tgtaatgaaaccggctattcgctgtctggtctcgctatgcagaacgaactggcgctgcac
agcaagaaagagatcgacgagtatttcgcgcatgtctggcaaaccatgcaggcatgtatc
gatcgcgggatgaacaccgaaggtgtactgccaggcccgctgcgcgtgccacgtcgtgcg
tctgccctgcgccggatgttagtttccagcgataaactgtctaacgatccgatgaatgtc
attgactgggtaaacatgtttgcgctggcagttaacgaagaaaacgccgccggtggtcgt
gtggtaactgcgccaaccaacggtgcctgcggtatcgttccggcagtgctggcttactat
gaccactttattgaatcggtcagcccggacatctatacccgttactttatggcagcgggc
gcgattggtgcattgtataaaatgaacgcctctatttccggtgcggaagttggttgccag
ggcgaagtgggtgttgcctgttcaatggctgctgcgggtcttgcagaactgctgggcggt
agcccggaacaggtttgcgtggcggcggaaattggcatggaacacaaccttggtttaacc
tgcgacccggttgcagggcaggttcaggtgccgtgcattgagcgtaatgccattgcctct
gtgaaggcgattaacgccgcacggatggctctgcgccgcaccagtgcaccgcgcgtctcg
ctggataaggtcatcgaaacgatgtacgaaaccggtaaggacatgaacgccaaataccgc
gaaacctcacgcggtggtctggcaatcaaagtccagtgtgactaa

DBGET integrated database retrieval system