KEGG   Escherichia coli B REL606: ECB_01793Help
Entry
ECB_01793         CDS       T00944                                 

Gene name
cspC
Definition
(GenBank) stress protein, member of the CspA-family
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ebr03000]
    ECB_01793 (cspC)
Transcription factors [BR:ebr03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ECB_01793 (cspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: ACT39454
Position
complement(1885805..1886014)
Genome map
AA seq 69 aa AA seqDB search
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PAAVNVTAI
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattaaaggtcaggttaagtggttcaacgagtctaaaggttttggcttcatt
actccggctgatggcagcaaagacgtgttcgtacacttctccgctatccagggtaatggc
ttcaaaactctggctgaaggtcagaacgttgagttcgaaattcaggacggccagaaaggt
ccggcagctgttaacgtaacagctatctga

DBGET integrated database retrieval system