KEGG   Escherichia coli B REL606: ECB_01800Help
Entry
ECB_01800         CDS       T00944                                 

Gene name
htpX
Definition
(GenBank) heat shock protein HtpX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
ebr  Escherichia coli B REL606
Module
ebr_M00743  Aminoglycoside resistance, protease HtpX
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ebr01002]
    ECB_01800 (htpX)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     ECB_01800 (htpX)
Peptidases [BR:ebr01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   ECB_01800 (htpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M56 Peptidase_M1
Motif
Other DBs
NCBI-ProteinID: ACT39461
Position
complement(1890272..1891153)
Genome map
AA seq 293 aa AA seqDB search
MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR
SVGGEVIEQPRNERERWLINTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV
STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG
NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA
ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaatcgcgctcttcctgctaacgaacctggccgtaatggtcgttttcgggctg
gtactgagcctgacagggatacagtcgagcagcgttcaggggctgatgatcatggccttg
ctgttcggttttggtggttccttcgtttcgcttctgatgtccaaatggatggcattacga
tctgttggcggggaagtgatcgagcaaccgcgtaacgaaagggaacgttggctgattaat
actgtagcaacccaggctcgtcaggcagggatcgctatgccgcaagtggctatctaccat
gcgccggacatcaacgcttttgcaaccggtgcgcgccgtgatgcctctctggttgctgtc
agcaccggtttgctgcagaacatgagcccggatgaagccgaggcggtaattgctcacgaa
atcagccacatcgccaatggtgatatggtcaccatgacgctgattcagggcgtggtgaac
accttcgttatctttatttcccgtattctggcgcagcttgccgcgggttttatgggcgga
aatcgtgatgaaggtgaagagagcaacggcaacccgctgatctactttgcggttgcaacg
gttctggaactggtgtttggtattcttgcgagcattatcaccatgtggttctcgcgtcat
cgtgaattccatgctgatgccggttcggcaaaactggttggtcgcgagaaaatgattgcc
gcgctgcagcgcctgaaaaccagctatgaaccgcaagaagcaaccagcatgatggctttc
tgcattaacggtaagtcgaaatcgctcagtgagttgttcatgactcacccgccgctggat
aaacgaattgaagctctgcgtacgggtgaatacctgaagtaa

DBGET integrated database retrieval system