KEGG   Escherichia coli B REL606: ECB_01801Help
Entry
ECB_01801         CDS       T00944                                 

Gene name
prc
Definition
(GenBank) carboxy-terminal protease for penicillin-binding protein 3
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ebr01002]
    ECB_01801 (prc)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     ECB_01801 (prc)
Peptidases [BR:ebr01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   ECB_01801 (prc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 DUF3340 PDZ PDZ_2
Motif
Other DBs
NCBI-ProteinID: ACT39462
Structure
PDB: 

Position
complement(1891345..1893393)
Genome map
AA seq 682 aa AA seqDB search
MNMFFRLTALAGLLAIAGQTFAVEDITRADQIPVLKEETQHATVSERVTSRFTRSHYRQF
DLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTELGDELRSGKLDVFYDLYNLAQ
KRRFERYQYALSVLEKPMDFTGNDTYNLDRSKAPWPKNEAELNALWDSKVKFDELSLKLA
GKTDKEIRETLTRRYKFAIRRLAQTNSEDVFSLAMTAFAREIDPHTNYLSPRNTEQFNTE
MSLSLEGIGAVLQMDDDYTVINSMVAGGPAAKSKAISVGDKIVGVGQTGKPMVDVIGWRL
DDVVALIKGPKGSKVRLEILPAGKGTKTRTVTLTRERIRLEDRAVKMSVKTVGKEKVGVL
DIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR
DNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTV
QQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGGSTQRKGVTPDIIMPTGNEETETG
EKFEDNALPWDSIDAATYVKSGDLTAFGPELLKEHNARIAKDPEFQNIMKDIARFNAMKD
KRNIVSLNYAVREKENNEDDATRLARLNERFKREGKPELKKLDDLPKDYQEPDPYLDETV
NIALDLAKLEKARPAEQPAPVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgttttttaggcttaccgcgttagctggcctgcttgcaatagcaggccagacc
ttcgctgtagaagatatcacgcgtgctgatcaaattccggtattaaaggaagagacgcag
catgcgacggtaagtgagcgcgtaacgtcgcgcttcacccgttctcattatcgccagttc
gacctcgatcaggcattttcggccaaaatctttgaccgctacctgaatctgctcgattac
agccacaacgtgctgctggcaagcgatgttgaacagttcgcgaaaaagaaaaccgagtta
ggcgatgaactgcgttcaggcaaactcgacgttttctacgatctctacaatctggcgcaa
aagcgccgttttgagcgttaccagtacgctttgtcggtactggaaaagccgatggatttc
accggcaacgacacttataaccttgaccgcagcaaagcgccctggccgaaaaacgaggct
gagttgaacgcgctgtgggacagtaaagtcaaattcgacgagttaagcctgaagctggca
ggaaaaacggataaagaaattcgtgaaaccctgacacgccgctacaaatttgccattcgt
cgtctggcgcaaaccaacagcgaagatgttttctcgctggcaatgacggcgtttgcgcgt
gaaatcgacccgcataccaactatctttccccgcgtaataccgaacagttcaacactgaa
atgagtttgtcgctggaaggtattggcgcagtgctgcaaatggatgatgactacaccgtt
atcaattcgatggtggcaggtggtccggcagcgaagagtaaagctatcagcgttggtgac
aaaattgtcggtgttggtcaaacaggcaagccgatggttgacgtgattggctggcgtctt
gatgatgtggttgccttaattaaagggccgaagggcagtaaagttcgtctggaaatttta
cctgctggtaaagggaccaagacccgcactgtaacattgacccgtgaacgtattcgtctc
gaagaccgcgcggttaaaatgtcggtgaagaccgtcggtaaagagaaagtcggcgtgctg
gatattccgggcttctatgtgggtttgacagacgatgtcaaagttcaactgcagaaactg
gaaaaacagaatgtcagcagtgtgatcatcgacctgcgtagcaatggcggtggggcgctg
accgaagcggtatcgctctcaggtctgtttattcctgcgggtcccattgttcaggtccgc
gataacaacggcaaggttcgtgaagacagcgataccgacgggcaggtgttctataaaggc
ccgctggtggtactggttgaccgtttcagtgcttcggcttcagaaatctttgccgcggca
atgcaggattacggtcgtgcgctggttgtgggtgaaccgacgtttggtaaaggcaccgtt
cagcaataccgttcattgaaccgtatttacgatcagatgttacgtcctgaatggccagcg
ctgggttctgtgcagtacacgatccagaaattctatcgcgttaacggcggcagtacgcaa
cgtaaaggcgtaacgccagacatcatcatgccgacgggtaatgaagaaacggaaacgggt
gagaaattcgaagataacgcgctgccgtgggatagcattgatgccgcgacttatgtgaaa
tcaggcgatttaacggcctttgggccggagctgctgaaggaacataatgcgcgtatcgcg
aaagatcctgagttccagaacatcatgaaggatatcgcgcgcttcaacgctatgaaggac
aagcgcaatatcgtttctctgaactacgctgtgcgtgagaaagagaataatgaagatgat
gcgacgcgtctggcgcgtttgaacgaacgctttaaacgcgaaggtaaaccggagttgaag
aagctggatgatctacctaaagattaccaggagccggatccttatctggatgagacggtg
aatatcgcactcgatctggcgaagcttgaaaaagccagacccgcggaacaacccgctccc
gtcaagtaa

DBGET integrated database retrieval system