KEGG   Escherichia coli B REL606: ECB_01804Help
Entry
ECB_01804         CDS       T00944                                 

Gene name
yebS
Definition
(GenBank) conserved inner membrane protein
  KO
K03808  paraquat-inducible protein A
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ECB_01804 (yebS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PqiA zf-FPG_IleRS GAGA zinc_ribbon_4 zinc-ribbons_6 DZR Tmemb_55A
Motif
Other DBs
NCBI-ProteinID: ACT39465
Position
1894835..1896118
Genome map
AA seq 427 aa AA seqDB search
MALNTPQITPTKKITVRSIGEELPRGDYQRCPQCDMLFSLPEINSHQSAYCPRCQAKIRD
GRDWSLTRLAAMAFTMLLLMPFAWGEPLLHIWLLGIRIDANVMQGIWQMTKQGDTITGAM
VFFCVIGAPLILVSSIAYLWFGNRLGMNLRPVLLMLERLKEWVMLDIYLVGIGVASIKVQ
DYAHIQAGVGLFSFVALVILTTVTLSHLNVEELWERFYPQRPATRRDEKLRVCLGCHFTG
YPDQRGRCPRCHIPLRLRRRHSLQKCWAALLASIVLLLPANLLPISIIYLNGGRQEDTIL
SGIMSLASSNIAVAGIVFIASILVPFTKVIVMFTLLLSIHFKCQQGLRTRILLLRMVTWI
GRWSMLDLFVISLTMSLINRDQILAFTMGPAAFYFGAAVILTILAVEWLDSRLLWDAHES
GNARFDD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcttaacacaccacaaattacgccgacaaaaaagataacagtgaggtcaatcggc
gaggaactgccgcgtggtgattaccaacgttgcccgcaatgcgacatgctgtttagcctg
cccgagataaattctcatcagagtgcctattgtccgcgctgtcaggcaaaaattcgcgac
gggcgcgactggtcgctaacgcgcctggcggcaatggctttcaccatgctgttgctgatg
ccgtttgcctggggcgaaccgctgttgcatatctggctgttaggtattcgtatcgacgcc
aacgtcatgcaaggcatctggcaaatgaccaaacagggcgatacgataacgggggcgatg
gtctttttctgcgttattggtgcccccctcattctggtgtcctccatagcatatttatgg
tttggtaaccgactgggaatgaatttacgtccggtactgctgatgcttgagcgacttaaa
gagtgggtaatgctggatatctacctggtcggcattggcgttgcttctataaaggtacag
gattatgcccatatccaggcgggtgtcggcttgttctcttttgtggcgttggtgatttta
acgacggtgacgttgtcacatcttaatgtcgaggagctgtgggagcgattttatccgcag
cgccccgctacgcgtagggacgagaaacttcgtgtctgtcttgggtgccattttaccggc
tatcctgatcagcgtggtcgctgcccgcgttgccatatcccgctacgcctgcgtcgccgt
catagtttgcaaaaatgctgggcggcgctgttagcgtcaatcgttttgttgttacctgcc
aacctgttgcctatttctatcatttatctgaacggaggacggcaggaagatacaattctt
tccggaattatgtcgctggcaagtagcaacattgcggttgcgggaatcgtgtttatcgcc
agtattctggtaccgtttactaaagtgatcgtcatgttcactttactgttgagcattcat
tttaaatgccagcaaggtttacgcacacgcattctgttactgcggatggtgacctggatt
ggtcgctggtcgatgctcgacctgtttgtcatatctttaaccatgtcgctgattaatcgc
gatcagatcctcgcttttactatgggaccggctgcgttttatttcggcgcagcggtaatt
ttgactattcttgctgtggaatggctggacagccgcttactttgggatgcacatgagtca
ggaaacgcccgcttcgacgactga

DBGET integrated database retrieval system