KEGG   Escherichia coli B REL606: ECB_01810Help
Entry
ECB_01810         CDS       T00944                                 

Gene name
yebY
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2511
Motif
Other DBs
NCBI-ProteinID: ACT39471
Position
complement(1901941..1902282)
Genome map
AA seq 113 aa AA seqDB search
MMKKSILAFLLLTSSAAALAAPQVITVSRFEVGKDKWAFNREEVMLTCRPGNALYVINPS
TLVQYPLNDIAQKEVASGKTKAQPISVIQIDDPNNPGEKMSLAPFIERAEKLC
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaagtattctggcgtttctgttactcaccagttctgcagcggcgctggcg
gcaccgcaggtgattaccgtcagccgttttgaagtgggtaaagacaaatgggcgtttaat
cgcgaagaggtgatgctgacttgccgaccgggtaatgctttgtatgtcatcaacccaagt
accctcgtgcagtatcctttaaacgatatcgcacaaaaggaagttgccagtgggaagact
aaagcccagccgatttcggtgattcagattgatgatcctaacaatcccggcgaaaaaatg
agtctggcaccgtttatagaacgagctgaaaaactctgttaa

DBGET integrated database retrieval system