KEGG   Escherichia coli B REL606: ECB_01820Help
Entry
ECB_01820         CDS       T00944                                 

Gene name
purT
Definition
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00230  Purine metabolism
ebr00670  One carbon pool by folate
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01130  Biosynthesis of antibiotics
Module
ebr_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECB_01820 (purT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ECB_01820 (purT)
Enzymes [BR:ebr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     ECB_01820 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C ATP-grasp_3 CPSase_L_D2 Epimerase 2-Hacid_dh_C ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACT39481
Structure
PDB: 

Position
1909457..1910635
Genome map
AA seq 392 aa AA seqDB search
MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVIN
MLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRL
AAEELQLPTSTYRFADSESLFREAVAAIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWEY
AQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMS
PLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEF
ALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKPEIDG
SRRLGVALATAESVVDAIERAKHAAGQVKVQG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacgttattaggcactgcgctgcgtccggcagcaactcgcgtgatgttattaggctcc
ggtgaactgggtaaagaagtggcaatcgagtgtcagcgtctcggcgtagaggtgattgcc
gtcgatcgctatgccgacgcaccagccatgcatgtcgcgcatcgctcccatgtcattaat
atgcttgatggtgatgcattacgccgtgtggttgaactggaaaaaccacattatatcgtg
ccggagatcgaagctattgccaccgatatgctgatccaacttgaagaggaaggactgaat
gttgtcccctgcgctcgcgcaacgaaattaacgatgaatcgcgagggtatccgtcgcctg
gcggcagaagagctgcagctgcccacttccacttatcgttttgccgatagcgaaagcctt
ttccgcgaggcggttgccgccattggctatccctgcattgtaaaaccggtgatgagctct
tccggcaaggggcagacgtttattcgctctgcagagcaacttgctcaggcatgggaatac
gctcagcaaggcggtcgcgccggagcgggccgcgtaattgttgaaggcgtcgttaagttt
gacttcgaaattaccctgctaaccgtcagcgcggtggatggcgtccatttctgtgcacca
gtaggtcatcgccaggaagatggcgactaccgtgaatcctggcaaccacagcaaatgagc
ccgcttgcccttgaacgtgcgcaggagattgcccgtaaagtggtgctggcactgggcggt
tatggtctgtttggtgtcgagctgtttgtctgtggtgatgaggtgattttcagtgaggtc
tcccctcgtccacatgataccgggatggtgacgttaatttctcaagatctctcagagttt
gccctgcatgtacgtgccttcctcggacttcctgttggcgggatccgtcagtatggtcct
gcagcttctgccgttattctgccacaactgaccagtcagaatgtcacgtttgataatgtg
cagaatgccgtaggcgcagatttgcagattcgtttatttggtaagccggaaattgatggc
agccgtcgtctgggtgttgcgctggcgaccgctgagagtgttgttgacgccattgaacgc
gcgaagcacgccgccggacaggtaaaagtacagggttaa

DBGET integrated database retrieval system