KEGG   Escherichia coli B REL606: ECB_01821Help
Entry
ECB_01821         CDS       T00944                                 

Gene name
eda
Definition
(GenBank) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00030  Pentose phosphate pathway
ebr00630  Glyoxylate and dicarboxylate metabolism
ebr01100  Metabolic pathways
ebr01120  Microbial metabolism in diverse environments
ebr01200  Carbon metabolism
Module
ebr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
ebr_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
ebr_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECB_01821 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    ECB_01821 (eda)
Enzymes [BR:ebr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     ECB_01821 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     ECB_01821 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase HMGL-like
Motif
Other DBs
NCBI-ProteinID: ACT39482
Structure
PDB: 

Position
complement(1910691..1911332)
Genome map
AA seq 213 aa AA seqDB search
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAI
AKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLC
IGGSWLVPADALEAGDYDRITKLAREAVEGAKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactggaaaacaagtgcagaatcaatcctgaccaccggcccggttgtaccggtt
atcgtggtaaaaaaactggaacacgcagtgccgatggcaaaagcgttggttgctggtggg
gtgcgcgttctggaagtgactctgcgtaccgagtgtgcagttgacgctatccgtgctatc
gccaaagaagtgcctgaagcgattgtgggtgccggtacggtgctgaatccacagcagctg
gcagaagtcactgaagcgggtgcacagttcgcaattagcccgggtctgaccgagccgctg
ctgaaagctgctaccgaagggactattcctctaattccggggatcagcactgtttccgaa
ctgatgctgggtatggactacggtttgaaagagttcaaattcttcccggctgaagctaac
ggcggcgtgaaagccctgcaggcgatcgcgggtccgttctcccaggtccgtttctgcccg
acgggtggtatttctccggctaactaccgtgactacctggcgctgaaaagcgtgctgtgc
atcggtggttcctggctggttccggcagatgcgctggaagcgggcgattacgaccgcatt
actaagctggcgcgtgaagctgtagaaggcgctaagctgtaa

DBGET integrated database retrieval system