KEGG   Escherichia coli B REL606: ECB_03276Help
Entry
ECB_03276         CDS       T00944                                 

Gene name
glpE
Definition
(GenBank) thiosulfate sulfurtransferase
  KO
K02439  thiosulfate sulfurtransferase [EC:2.8.1.1]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00920  Sulfur metabolism
ebr01110  Biosynthesis of secondary metabolites
ebr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECB_03276 (glpE)
Enzymes [BR:ebr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     ECB_03276 (glpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ACT40924
Structure
PDB: 

Position
complement(3490098..3490424)
Genome map
AA seq 108 aa AA seqDB search
MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTP
VMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPAEVAYGA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggatcagttcgaatgtattaacgttgccgacgcgcaccagaagttgcaggaaaaagag
gcggtgctggtcgatattcgcgatccacagagtttcgctatggggcatgcggtgcaggct
ttccatttaaccaacgacacgctgggcgcgtttatgcgtgataacgactttgacactccg
gtgatggtgatgtgttatcacggcaatagcagcaaaggggcggcgcagtatctgctgcaa
cagggctacgatgtggtctatagcattgacggcggctttgaagcctggcagcgacagttt
cccgcagaggtggcgtacggcgcgtaa

DBGET integrated database retrieval system