KEGG   Escherichia coli B REL606: ECB_03285Help
Entry
ECB_03285         CDS       T00944                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00260  Glycine, serine and threonine metabolism
ebr00261  Monobactam biosynthesis
ebr00270  Cysteine and methionine metabolism
ebr00300  Lysine biosynthesis
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01120  Microbial metabolism in diverse environments
ebr01130  Biosynthesis of antibiotics
ebr01210  2-Oxocarboxylic acid metabolism
ebr01230  Biosynthesis of amino acids
Module
ebr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ebr_M00017  Methionine biosynthesis, apartate => homoserine => methionine
ebr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECB_03285 (asd)
   00270 Cysteine and methionine metabolism
    ECB_03285 (asd)
   00300 Lysine biosynthesis
    ECB_03285 (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECB_03285 (asd)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     ECB_03285 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACT40932
Structure
PDB: 

Position
complement(3505229..3506332)
Genome map
AA seq 367 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVYFSTSQLGQAAPSFGGTTGTLQDAFDL
EALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT
DGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMG
HLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNP
WAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLR
RMLRQLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttggttttatcggctggcgcggtatggtcggctccgttctcatgcaacgc
atggttgaagagcgcgacttcgacgccattcgccctgtctacttttctacttctcagctt
ggtcaggctgcgccgtcttttggcggaaccactggcacacttcaggatgcctttgatctg
gaggcgctaaaggccctcgatatcattgtgacctgtcagggcggcgattataccaacgaa
atctatccaaagcttcgtgaaagcggatggcagggttactggattgacgcagcatcgtct
ctgcgcatgaaagatgacgccatcatcattcttgaccccgtcaatcaggacgtcattacc
gacggattaaataatggcatcaggacttttgttggcggtaactgtaccgtaagcctgatg
ttgatgtcgttgggtggtttattcgccaatgatcttgttgattgggtgtccgttgcaacc
taccaggccgcttccggcggtggtgcgcgacatatgcgtgagttattaacccagatgggc
catctgtatggccatgtagcagatgaactcgcgaccccgtcctctgctattctcgatatc
gaacgcaaagtcacaaccttaacccgtagcggtgagctgccggtggataactttggcgtg
ccgctggcgggtagcctgattccgtggatcgacaaacagctcgataacggtcagagccgc
gaagagtggaaagggcaggcggaaaccaacaagatcctcaacacatcttccgtaattccg
gtagatggtttatgtgtgcgtgtcggggcattgcgctgccacagccaggcattcactatt
aaattgaaaaaagatgtgtcgattccgaccgtggaagaactgctggctgcgcacaatccg
tgggcgaaagtcgttccgaacgatcgggaaatcactatgcgtgagctaaccccagctgcc
gttaccggcacgctgaccacgccggtaggccgcctgcgtaagctgaatatgggaccagag
ttcctgtcagcctttaccgtgggcgaccagctgctgtggggggccgcggagccgctgcgt
cggatgcttcgtcaactggcgtaa

DBGET integrated database retrieval system