KEGG   Escherichia coli B REL606: ECB_03293Help
Entry
ECB_03293         CDS       T00944                                 

Gene name
yhhZ
Definition
(GenBank) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECB_03293 (yhhZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP Colicin-DNase HNH
Motif
Other DBs
NCBI-ProteinID: ACT40940
Position
3513316..3514494
Genome map
AA seq 392 aa AA seqDB search
MSNIVYLTVTGEQQGSISAGCGTSESTGNRWQSGHEDETFTFSLLNNINNTGLGSQFHGI
TFCKLIDKSTPLFINSINNNEQLFIGFDFYRINRFGRWEKYYYIQLRGAFLSAIHHQIIE
NQLDTEKITISYEFILCQHLIANTEFSYLALPENYNRLFLPNSKNQTNNRFKTLNSKAIG
RLLAAGGVYNGNIEGFRDTAEKLGGDAIKGYDQILNEKTAGIAIATASILLTKRSNVDTY
TEINSYLGKLRGQQKLLDGIDIIEIIYIKRPSKDLANLRKEFNKTVRKNFLIKLAKTSEA
SGRFNAEDLLRMRKGNVPLNYNVHHKLSLDDGGTNDFENLVLIENEPYHKVFTNMQSRIA
KGILVGESKITPWAIPSGSIYPPMKNIMDHTK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatattgtttacctgacagtaacgggagaacaacaaggaagcatctccgcaggt
tgtgggacttctgagtctacaggtaatcgttggcagagcgggcatgaggatgaaacattt
acattctcactcttaaataatattaataatacggggcttggttcacagttccatggtata
acattttgtaaattaattgataaaagcactccattatttattaattccattaacaataat
gaacaattatttataggatttgacttctatcgaataaatagatttggtagatgggaaaag
tattattatatacaactaagaggcgcttttttatcggctattcatcaccagatcattgaa
aaccaactggatacagaaaaaataactattagttatgaatttatcctctgtcaacatctt
atcgcaaataccgagttcagctatttggcactccctgaaaattataaccgtttgttttta
ccaaattcaaaaaaccaaacaaataatcgtttcaaaacgttaaacagcaaagctattggc
aggctacttgctgctggtggcgtatacaatgggaacattgaaggattcagagatactgcg
gaaaaactgggtggagatgcaataaaaggctatgatcaaatactaaatgaaaaaacagcg
ggcatagcgatagcaacagcatctattcttttaacaaagcgttctaatgttgatacatat
acagaaataaatagttacttaggcaaacttagaggtcaacaaaaacttcttgatggtata
gacataatagaaataatatacattaagagaccttcaaaagacttagctaacttacgaaag
gagtttaataaaactgtaagaaaaaattttcttatcaaacttgcaaaaacctccgaagca
tctggaagattcaacgccgaagaccttttaagaatgagaaagggcaatgttcctctaaat
tataatgttcaccataaactatctctagatgatggtggtactaatgatttcgaaaattta
gtattaatcgaaaacgaaccatatcataaagtttttactaacatgcaatcacgaatagct
aagggaatattagtaggtgaaagcaaaatcactccctgggccattccatctggctcaatt
tatcctcccatgaaaaatattatggaccacacaaaatga

DBGET integrated database retrieval system