KEGG   Escherichia coli B REL606: ECB_03307Help
Entry
ECB_03307         CDS       T00944                                 

Gene name
livK
Definition
(GenBank) leucine transporter subunit
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
ebr  Escherichia coli B REL606
Pathway
ebr02010  ABC transporters
ebr02024  Quorum sensing
Module
ebr_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECB_03307 (livK)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECB_03307 (livK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebr02000]
    ECB_03307 (livK)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    ECB_03307 (livK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Fe-ADH PGM_PMM_I
Motif
Other DBs
NCBI-ProteinID: ACT40954
Structure
PDB: 

Position
complement(3527125..3528234)
Genome map
AA seq 369 aa AA seqDB search
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRHFRSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaatgcgaaaactatcatcgcagggatgattgcactggcaatttcacacacc
gctatggctgacgatattaaagtcgccgttgtcggcgcgatgtccggcccgattgcccag
tggggcgatatggaatttaacggcgcgcgtcaggcgattaaagacattaatgccaaaggg
ggaattaagggcgacaagctggttggcgtggaatatgacgacgcctgcgacccgaaacaa
gccgttgcggtcgccaacaaaatcgttaatgacggcattaaatacgttattggtcatctg
tgttcttcttctacccaacctgcatcagatatctacgaagacgaaggtattctgatgatc
tcgccgggagcgaccaacccggagctgacccaacgcggttatcaacacattatgcgtact
gccgggctggactcttcccaggggccaacggcggcaaaatacattcttgagacggtgaag
ccccagcgcatcgccatcattcacgacaaacaacagtatggcgaagggctggcgcgttcg
gtgcaggacgggctgaaagcggctaacgccaacgtcgtcttcttcgacggtattaccgcc
ggggagaaagatttctccgcgctgatcgcccgcctgaaaaaagaaaacatcgacttcgtt
tactacggcggttactacccggaaatggggcagatgctgcgccatttccgttccgttggc
ctgaaaactcagtttatggggccggaaggtgtgggtaacgcatcattgtcgaatattgcc
ggtgatgctgccgaaggcatgttggtcactatgccaaaacgctatgaccaggatccggca
aaccagggcatcgttgatgcgctgaaagcagacaagaaagatccgtccgggccttatgtc
tggatcacttacgcggcggtgcaatctctggcaacagcccttgagcgtaccggcagcgat
gagccgctggcgctggtgaaagatttaaaagcaaacggtgcaaacaccgtgattgggccg
ctgaactgggatgaaaaaggcgatcttaagggatttgattttggtgtcttccagtggcac
gccgacggttcatccacggcagccaagtga

DBGET integrated database retrieval system