KEGG   Escherichia coli B REL606: ECB_03308Help
Entry
ECB_03308         CDS       T00944                                 

Gene name
yhhK
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3749 Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-ProteinID: ACT40955
Structure
PDB: 

Position
3528658..3529041
Genome map
AA seq 127 aa AA seqDB search
MKLTIIRLENFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTE
GALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQ
QGGWEKR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaccatcattcgattagaaaactttagcgaccaggaccggattgacctgcaa
aagatctggccggagtattccccttcctctttacaggttgacgataaccaccgtatctac
gccgcgcgttttaacgagcgcctgctcgctgccgtacgggtaaccttaagcggcaccgag
ggagcactggattccctgcgtgtgcgggaagtcacccgacgtcgcggtgtggggcaatat
ctgctggaagaggttttgcgtaacaatcctggcgtttcatgctggtggatggcggatgca
ggcgtggaagatcgcggtgtgatgacggcgtttatgcaggcactgggatttacggcgcaa
cagggcggctgggagaagcgttaa

DBGET integrated database retrieval system