KEGG   Escherichia coli B REL606: ECB_03310Help
Entry
ECB_03310         CDS       T00944                                 

Gene name
rpoH
Definition
(GenBank) RNA polymerase sigma factor
  KO
K03089  RNA polymerase sigma-32 factor
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ebr03021]
    ECB_03310 (rpoH)
Transcription machinery [BR:ebr03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ECB_03310 (rpoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r1_2 KORA HTH_10 HTH_AsnC-type UCR_14kD HTH_25 HTH_3 SANT_DAMP1_like DUF5412
Motif
Other DBs
NCBI-ProteinID: ACT40957
Position
complement(3530614..3531468)
Genome map
AA seq 284 aa AA seqDB search
MTDKMQSLALAPVGNLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRF
VVHIARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDM
TFDLSSDDDSDSQPMAPVLYLQDKSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDII
RARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRAAIEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaatgcaaagtttagctttagccccagttggcaacctggattcctacatc
cgggcagctaacgcgtggccgatgttgtcggctgacgaggagcgggcgctggctgaaaag
ctgcattaccatggcgatctggaagcagctaaaacgctgatcctgtctcacctgcggttt
gttgttcatattgctcgtaattatgcgggctatggcctgccacaggcggatttgattcag
gaaggtaacatcggcctgatgaaagcagtgcgccgttttaacccggaagtgggtgtgcgc
ctggtctccttcgccgttcactggatcaaagcagagatccacgaatacgtcctgcgtaac
tggcgtatcgtcaaagttgcgaccaccaaagcgcagcgcaaactgttcttcaacctgcgt
aaaaccaagcagcgtctgggctggtttaaccaggatgaagtcgaaatggtggcccgtgaa
ctgggcgtaaccagcaaagacgttcgtgagatggaatcacgtatggcggcacaggacatg
acctttgacctgtcttccgacgacgattccgacagccagccgatggcaccggtgctctat
ctgcaggataaatcatctaactttgccgacggcatcgaagatgataactgggaagagcag
gcggcaaaccgtctgaccgacgcgatgcagggtctggacgaacgcagccaggacatcatc
cgtgcgcgctggctggacgaagacaacaagtccacgttgcaggaactggctgaccgttac
ggtgtttccgctgaacgtgtgcgccaactggaaaagaacgcgatgaaaaaattgcgtgct
gctatagaagcgtaa

DBGET integrated database retrieval system