KEGG   Escherichia coli B REL606: ECB_03370Help
Entry
ECB_03370         CDS       T00944                                 

Gene name
yhjD
Definition
(GenBank) conserved inner membrane protein
  KO
K07058  membrane protein
Organism
ebr  Escherichia coli B REL606
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ECB_03370 (yhjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ACT41016
Position
3602854..3603867
Genome map
AA seq 337 aa AA seqDB search
MTQENEIKRPIQDLEHEPIKPLDNSEKGSKVSQALETVTTTAEKVQRQPVIAHLIRATER
FNDRLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQNISDPTLA
ATLKNTINTAVQQRTTVGLVGLAVALYSGINWMGNLREAIRAQSRDVWERSPQDQEKFWV
KYLRDFISLIGLLIALIVTLSITSVAGSAQQMIISALHLNSIEWLKPTWRLIGLAISIFA
NYLLFFWIFWRLPRHRPRKKALIRGTFLAAIGFEVIKIVMTYTLPSLMKSPSGAAFGSVL
GLMAFFYFFARLTLFCAAWIATAEYKDDPRMPGKTQP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaaacgagatcaaacgtcccatccaggatctggagcacgagccgattaag
ccgttggataatagcgagaaaggcagcaaagttagccaggcgctggaaaccgtcaccacc
actgccgaaaaagtccaacgccaaccggttattgcgcacctgattcgcgcgacagaacgc
tttaacgatcggctgggtaaccagtttggtgcggctatcacctatttctcatttttgtcg
atgataccaattttgatggtgtcgtttgccgcagggggctttgtgctggcctcccatccg
atgttgctacaggatatcttcgacaaaattctgcaaaacatcagcgatccgacgctagcc
gccacgttgaaaaacaccatcaacaccgccgttcagcagcgtacgactgtagggcttgtc
ggcctggcggtggcactttattccggcatcaactggatgggtaacctgcgtgaagcgatt
cgtgcccagtcgcgcgatgtctgggaacgctcgccgcaagatcaggagaagttctgggta
aaatatctgcgagattttatttcgctgattggtttgttgattgcgctgattgtgacgctt
tcgatcacctcggttgccggttcggcgcagcaaatgattattagcgccctgcacctgaac
agcattgagtggctgaaaccgacgtggcgattgattggcctggcgatttccatcttcgcc
aactatctgcttttcttctggatcttctggcggttgccgcgccaccgtccgcgcaaaaaa
gccctgattcgcggaacatttctggctgctattggttttgaagtgattaaaatcgtgatg
acctacaccctgccatcgttgatgaaatccccctctggcgcagcatttggttccgtgctg
gggctgatggcatttttctacttcttcgcccgtttgacgctgttttgcgcggcgtggatt
gccaccgccgaatataaagacgacccgcgaatgccggggaaaacgcagccttaa

DBGET integrated database retrieval system