KEGG   Escherichia coli B REL606: ECB_03378Help
Entry
ECB_03378         CDS       T00944                                 

Gene name
bcsC
Definition
(GenBank) cellulose synthase subunit
  KO
K20543  cellulose synthase operon protein C
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECB_03378 (bcsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCSC_C TPR_19 TPR_16 TPR_2 TPR_14 TPR_8 TPR_12 TPR_7 TPR_1 TPR_20 TPR_11 TPR_15 RPN7 BTAD TPR_17 TPR_9 TPR_10
Motif
Other DBs
NCBI-ProteinID: ACT41024
Position
complement(3615192..3618665)
Genome map
AA seq 1157 aa AA seqDB search
MRKFTLNIFTLSLGLTVMPMVEAAPTAQQQLLEQVRLGEATHREDLVQQSLYRLELIDPN
NPDVVAARFRSLLRQGDIDGAQKQLDRLSQLAPSSNAYKSSRTTMLLSTPDGRQALQQAR
LQATTGHAEEAVASYNKLFNGAPPEGDIAVEYWSTVAKIPARRGEAINQLKRINADTPGN
TGLQNNLALLLFSSDRRDEGFAVLEQMAKSNAGREGASKIWYGQIKDMPVSDASVSALKK
YLSIFSDGDSVAAAQSQLAEQQKQLADPAFRARAQGLAAVDSGMAGKAIPELQQAVRANP
KDSEALGALGQAYSQKGDRANAVANLEKALALDPHSSNNDKWNSLLKVNRYWLAIQQGDA
ALKANNPDRAERLFQQARNVDNTDSYAVLGLGDVAMARKDYPAAERYYQQTLRMDSGNTN
AVRGLANIYRQQSPEKAEAFIASLSASQRRSIDDIERSLQNDRLAQQAEALENQGKWAQA
AALQRQRLALDPGSVWITYRLSQDLWQAGQRSQADTLMRNLAQQKPNDPEQVYAYGLYLS
GHDQDRAALAHINSLPRAQWNSNIQELVNRLQSDQVLETANRLRESGKEAEAEAMLRQQP
PSTRIDLTLADWAQQRRDYTAARAAYQNVLTREPANADAILGLTEVDIAAGDKAAARSQL
AKLPATDNASLNTQRRVALAQAQLGDTAAAQRTFNKLIPQAKSQPPSMESAMVLRDGAKF
EAQAGDPTQALETYKDAMVASGVTTTRPQDNDTFTRLTRNDEKDDWLKRGVRSDAADLYR
QQDLNVTLEHDYWGSSGTGGYSDLKAHTTMLQVDAPYSDGRMFFRSDFVNMNVGSFSTNA
DGKWDDNWGTCTLQDCSGNRSQSDSGASVAVGWRNDVWSWDIGTTPMGFNVVDVVGGISY
SDDIGPLGYTVNAHRRPISSSLLAFGGQKDSPSNTGKKWGGVRADGVGLSLSYDKGEANG
VWASLSGDQLTGKNVEDNWRVRWMTGYYYKVINQNNRRVTIGLNNMIWHYDKDLSGYSLG
QGGYYSPQEYLSFAIPVMWRERTENWSWELGASGSWSHSRTKTMPRYPLMNLIPTDWQEE
AARQSNDGGSSQGFGYTARALLERRVTSNWFVGTAIDIQQAKDYAPSHFLLYVRYSAAGW
QGDMDLPPQPLIPYADW
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaattcacactaaacatattcacgctttccctcggtctgaccgtcatgccgatg
gtcgaggcagcaccaaccgctcagcaacagttgctggagcaagttcggttaggcgaagcg
acccatcgtgaagatctggtgcaacagtcgttatatcggctggaacttattgatccgaat
aatccggacgtcgttgccgcccgtttccgttctttgttacgtcagggcgatattgatggt
gcgcaaaaacagcttgatcggctgtcgcagttagcgccgagttcaaatgcgtataaatcg
tcgcggactacgatgctactttccacgccggatggtcgtcaggcactgcaacaggcaaga
ttgcaggcgactaccggtcatgcggaagaagctgtggcgagttacaacaaactgttcaac
ggtgcgccgccggaaggtgacattgctgtcgagtactggagtacggtggcgaaaattccg
gctcgccgtggcgaagcgattaatcagctaaaacgcattaatgcggatacgccgggcaat
acgggcctgcaaaacaatctggcgctattgctgtttagtagcgatcgccgtgacgaaggt
tttgccgtcctggaacagatggcgaaatcgaacgccgggcgcgaaggggcctctaaaatc
tggtacgggcagattaaagacatgcccgtcagcgatgccagtgtgtcggcgctgaaaaaa
tatctttcgatctttagtgatggcgatagcgtggcggctgcgcaatcgcaactggcagaa
cagcaaaaacagctggccgatcctgctttccgcgctcgtgcgcaaggtttagcggcggtg
gactctggtatggcgggtaaagccattcccgaactacaacaggcagtgcgggcgaacccg
aaagacagtgaggctctgggggcgctgggccaggcatattcacagaaaggcgatcgcgcc
aatgcagtggcgaatctggaaaaagccctcgcactggacccgcacagcagcaacaacgac
aaatggaatagtctgctgaaagtgaaccgctactggctggcgatccagcagggcgatgct
gcgctgaaagccaataatcctgaccgggcagaacgcctgttccagcaggcgcgtaatgtc
gataacaccgacagttatgcagtgctggggctgggcgatgtggcgatggcgcgaaaagat
tatcccgccgccgaacgttattatcagcagaccttgcgtatggacagcggcaacactaac
gccgtgcgcgggctggcaaatatttaccgccagcaatcgccagaaaaagctgaagcgttt
atcgcctcgctctctgccagtcagcggcgtagcattgatgatatcgaacgcagcctgcaa
aacgaccgtctggcacagcaggcagaggcactggaaaaccagggcaaatgggcgcaggcg
gcagcacttcagcggcaacgactggcgctggaccccggcagtgtatggattacttaccga
ctttcgcaggatctctggcaggccggacaacgcagccaggccgatacgttaatgcgcaat
ctggcgcagcagaagccgaatgacccggagcaggtttacgcttacgggctgtatctctct
ggtcatgaccaggacagagcggcgctggcgcatatcaacagcctgccgcgtgcgcagtgg
aacagcaatattcaggagctggttaatcgactgcaaagcgatcaggtgctggaaaccgct
aaccgcctgcgagaaagcggcaaagaggcagaagcggaagcgatgctgcgccagcaacca
ccttccacgcgtattgacctcacgctggctgactgggcgcaacaacgacgtgattacacc
gccgcccgcgctgcatatcagaatgtcctgacgcgggagccagctaacgccgacgccatt
cttggtctgacggaagtggatattgctgccggtgacaaagcggcggcacgtagccagctg
gcgaaactgcccgctaccgataacgcctcgctgaacacacagcggcgcgtggcgctggca
caggcgcagcttggcgataccgcagcagcgcagcggacgtttaataagttgatcccgcag
gcaaaatctcagccaccgtcgatggaaagcgcgatggtgctgcgtgatggtgcgaagttt
gaagcgcaggcgggcgatccaacgcaggcgctggaaacctacaaagacgccatggtcgca
tccggtgtgactacgacgcgtccgcaggataacgacacctttacccgactgacccgtaac
gacgagaaagatgactggctgaaacgtggcgtgcgcagcgatgcggcggacctctatcgc
cagcaggatcttaacgtcacccttgagcacgattactggggttcgagcggcaccggtggt
tactccgatctgaaagcgcacactaccatgttgcaggtggatgcgccgtattctgacggg
cggatgttctttcgcagtgatttcgtcaatatgaacgtcggcagtttctccactaatgcc
gatggcaaatgggatgacaactggggcacctgtacattacaggactgtagcggcaaccgc
agccagtcggactccggtgccagcgtggcggtcggctggcgaaatgacgtctggagctgg
gatatcggtaccacgccgatgggcttcaacgtggtggatgtggtcggcggcatcagttac
agcgatgatatcgggccgctgggttacaccgttaacgcccaccgtcggcccatctccagt
tctttgctggcctttggtgggcaaaaagactccccgagcaataccgggaaaaaatggggt
ggcgtacgtgccgacggtgtggggctaagtctgagctacgataaaggtgaagcaaacggc
gtctgggcatcgcttagtggcgaccagttaaccggtaaaaatgtcgaagataactggcgc
gtgcgctggatgacgggctattactataaggtcattaaccagaacaatcgccgcgtcaca
atcggcctgaacaacatgatctggcattacgacaaagatctgagtggctactcactcggt
cagggcggttactacagtccgcaggaatacctgtcgtttgccataccggtgatgtggcgg
gagcgcacggaaaactggtcgtgggagctgggtgcgtctggctcgtggtcgcattcacgc
accaaaaccatgccgcgttatccgctgatgaatctgatcccgaccgactggcaggaagaa
gctgcgcggcaatccaacgatggcggcagcagtcagggcttcggctacacggcgcgggca
ttacttgaacgacgtgttacttccaactggtttgttggcacggcaattgatatccagcag
gcgaaagattacgcacccagccatttcctgctctacgtacgttattccgccgccggatgg
cagggtgacatggatttaccgccgcagccgctgataccttacgccgactggtaa

DBGET integrated database retrieval system