KEGG   Escherichia coli B REL606: ECB_03804Help
Entry
ECB_03804         CDS       T00944                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00010  Glycolysis / Gluconeogenesis
ebr00051  Fructose and mannose metabolism
ebr00562  Inositol phosphate metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01120  Microbial metabolism in diverse environments
ebr01130  Biosynthesis of antibiotics
ebr01200  Carbon metabolism
ebr01230  Biosynthesis of amino acids
Module
ebr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebr_M00002  Glycolysis, core module involving three-carbon compounds
ebr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECB_03804 (tpiA)
   00051 Fructose and mannose metabolism
    ECB_03804 (tpiA)
   00562 Inositol phosphate metabolism
    ECB_03804 (tpiA)
Enzymes [BR:ebr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECB_03804 (tpiA)
Exosome [BR:ebr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECB_03804 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECB_03804 (tpiA)
  Exosomal proteins of melanoma cells
   ECB_03804 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACT41441
Structure
PDB: 

Position
complement(4090222..4090989)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacccgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcattcgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system