KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_1891Help
Entry
ECTOBSL9_1891     CDS       T04374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00071  Fatty acid degradation
ebs00072  Synthesis and degradation of ketone bodies
ebs00280  Valine, leucine and isoleucine degradation
ebs00310  Lysine degradation
ebs00362  Benzoate degradation
ebs00380  Tryptophan metabolism
ebs00620  Pyruvate metabolism
ebs00630  Glyoxylate and dicarboxylate metabolism
ebs00640  Propanoate metabolism
ebs00650  Butanoate metabolism
ebs00900  Terpenoid backbone biosynthesis
ebs01100  Metabolic pathways
ebs01110  Biosynthesis of secondary metabolites
ebs01120  Microbial metabolism in diverse environments
ebs01130  Biosynthesis of antibiotics
ebs01200  Carbon metabolism
ebs01212  Fatty acid metabolism
ebs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECTOBSL9_1891
   00630 Glyoxylate and dicarboxylate metabolism
    ECTOBSL9_1891
   00640 Propanoate metabolism
    ECTOBSL9_1891
   00650 Butanoate metabolism
    ECTOBSL9_1891
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECTOBSL9_1891
   00072 Synthesis and degradation of ketone bodies
    ECTOBSL9_1891
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECTOBSL9_1891
   00310 Lysine degradation
    ECTOBSL9_1891
   00380 Tryptophan metabolism
    ECTOBSL9_1891
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECTOBSL9_1891
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECTOBSL9_1891
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECTOBSL9_1891
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebs04147]
    ECTOBSL9_1891
Enzymes [BR:ebs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECTOBSL9_1891
Exosome [BR:ebs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECTOBSL9_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANB02481
UniProt: A0A167ASI8
Position
1995496..1996683
Genome map
AA seq 395 aa AA seqDB search
MADSTVIVGAARTPVGTFNGSLAKIPASTLGALVIKGLLERTGMSPEQVDELILGQVLQA
GVGQNAARQAAVEAGIPYTSPAMTINKVCGSGLKSVQLAWQAIRCGDAGVVIAGGQENMS
ASPHVLPNSRQGTKMGDWKMVDTMIRDGLWCAFNDYHMGTTAENVATEFKISREEQDAFA
AQSQQRAEAAQKAGHFKDEIIPVEVPGRKRGETTIFDTDEFPRHGTTAEGLGKLRPAFSR
DGTVTAGNASGINDGAAAVIVMSESKAREWGLTPLARIVSFSSAGVDPAIMGTGPIPAAT
QCLEKAGWKPTDLDMVEANEAFAAQAIAVNKTMGWDLSKVNVSGGAIAIGHPIGASGARV
LVTLLHGMKRTGAQKGLATLCIGGGQGVALAVESV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctgattccacggtcatcgtcggtgctgcccgcacccccgtcggtacgttcaatggt
tccctggcgaagattcccgcttccaccctcggggctctggtcatcaagggattgctggaa
cggacgggaatgtcccctgaacaggtggatgagctcatcctggggcaggtgctgcaggcc
ggcgtgggccagaacgctgcccgtcaggcagcggtggaggcgggcatcccgtacacctcc
ccggccatgaccatcaacaaggtgtgcggcagcggcctcaagtcggtgcagctggcctgg
caggccattcgctgcggtgatgccggcgtcgtcatcgccggaggtcaggaaaacatgagc
gcatcgccgcacgtgctgccgaactcccgtcagggcaccaagatgggggactggaagatg
gtggacaccatgatccgcgatggcctttggtgtgccttcaatgactatcatatgggcacc
acggccgagaacgtggccaccgagttcaagatcagccgcgaggagcaggacgcctttgcc
gctcagtcgcaacagcgggccgaggcggcccagaaggccggtcacttcaaggatgagatc
attcccgtggaggtgcctggtcgcaagcggggtgaaaccacgattttcgataccgacgag
tttccccggcatggcaccaccgccgaaggtctgggcaaactgcgccccgccttcagtcgc
gacggtacggtgaccgccggcaatgcctccggcatcaacgacggcgccgccgccgtgatc
gtcatgtctgaatccaaggcccgtgaatggggcctcaccccgctggcgcgcatcgtgtcc
ttctcctcggcgggggtggacccggccatcatgggcaccggccccattccagcggccact
caatgtctggaaaaggctggctggaagcccacggatctggatatggtggaagccaatgag
gcctttgccgctcaggccattgccgtcaacaagacaatgggttgggatctgtccaaggtg
aacgtcagtggtggcgccattgccattggccaccccatcggcgcctccggtgcccgcgtg
ctggtcaccctgctgcatggcatgaagcgcaccggtgcccagaagggtctggcaaccctg
tgcatcggcggtggtcagggtgtggcgctggcggtggagagcgtctga

DBGET integrated database retrieval system