KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_2145Help
Entry
ECTOBSL9_2145     CDS       T04374                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00480  Glutathione metabolism
ebs00590  Arachidonic acid metabolism
ebs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ECTOBSL9_2145
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECTOBSL9_2145
Enzymes [BR:ebs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECTOBSL9_2145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ANB02690
UniProt: A0A167AX17
Position
complement(2284098..2284652)
Genome map
AA seq 184 aa AA seqDB search
MIRFLLVCLLIPLLASPAFAVQEPPGYAELFDHDMRRLHSSEVVNLRERFAGQPLLIVNT
ASHCGFTGQFSGLEAVHEKYADRGLKVMGFPSNDFNQEASDEAETARVCFRNFGVSFDMF
APIGVRGDDAHPIFQELARQSRAPRWNFYKYLVDRNGQVVAAYSSMVSPESRRFERAIED
LLGN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatccgattcctgctcgtctgcctgctgattcccttgcttgcgtccccggcttttgcg
gtgcaggaaccgcccggctatgcagagcttttcgatcacgacatgcggcgcctgcattcc
agcgaggtggtgaacctgcgggagcgattcgctggccagccgttgctgatcgtcaatacc
gcgagccattgcggctttaccggtcagttctcgggcctggaagcggtccatgaaaaatac
gccgacagggggctcaaggtgatgggatttccctccaacgacttcaatcaggaggccagc
gacgaggcagagacggcccgggtgtgctttcgcaacttcggggtgagcttcgacatgttc
gcacccattggggtccggggagatgacgcccatcccatcttccaggaactggcgcgacag
agccgtgcgccccgctggaacttctacaagtatctggtggaccggaacggccaggtggtc
gccgcctattccagcatggtttccccggagtcccgccgcttcgaacgggccatcgaggat
ctgctgggcaactaa

DBGET integrated database retrieval system