KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_2264Help
Entry
ECTOBSL9_2264     CDS       T04374                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00350  Tyrosine metabolism
ebs00360  Phenylalanine metabolism
ebs00380  Tryptophan metabolism
ebs01100  Metabolic pathways
ebs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ECTOBSL9_2264
   00360 Phenylalanine metabolism
    ECTOBSL9_2264
   00380 Tryptophan metabolism
    ECTOBSL9_2264
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebs04147]
    ECTOBSL9_2264
Enzymes [BR:ebs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     ECTOBSL9_2264
    4.1.1.105  L-tryptophan decarboxylase
     ECTOBSL9_2264
Exosome [BR:ebs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECTOBSL9_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Cys_Met_Meta_PP MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ANB02785
UniProt: A0A167AZ01
Position
complement(2425988..2427373)
Genome map
AA seq 461 aa AA seqDB search
MNHDDLRDWSRRAADWIHDYHEGLRERPVRAQTRPGDTRAQLASQAPEQPEPMEAIFEDF
ARIVPDAMTHWQHPRFFAYFPGNASPASMLAEQLANAMAAQAMLWQTSPAATEMEEVMVT
WLRDALGLDPHFTGTLHDSATTATLSAILTMREKALNWLGNSQGLQGQPTLRLYASEHVH
SSIDKDVRIAGIGQDNLVKIPTDAAHAMDMKALDAAIRADREAGHLPAGIILCVGGTGIG
ACDRIADGVAVARVHGLPTHVDAAWAGSAMICPEYRHLWEGIDGADSIVFNPHKWLGVQF
DCSVQFLADPAPQVRTLGLRPEYLKTLGKSSSMTDFNEWTVPLGRRFRALKIWFTLRAYG
LEGLRQRIRNHVTWAQELAKTLATLPGVQVVTLPQLSLFSFALESGDAATETLLKRINDD
GRVYLTQTRHDGRLVIRVQVGQFDCTREDVMCVYQVVKELL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgacgacctgagggactggtccaggcgggcggcggactggatccatgactat
catgaagggctgcgcgagcggcccgtgcgagcgcagacccgtcccggcgatacccgcgcc
cagctggccagccaggcgccggaacaacccgagcccatggaggccatcttcgaggatttt
gcccgcatcgtgcccgatgccatgacccactggcagcatccgcgattcttcgcctacttc
cccggcaatgcctcgcccgcctccatgctggccgagcaactggccaatgccatggccgcc
caggccatgctctggcagacctctccggcggccacggagatggaagaggtcatggtcacc
tggctgcgggacgccctggggctggacccgcatttcaccggcaccctgcacgacagcgcc
accactgccaccctctccgccatcctcaccatgcgcgagaaggcgctgaactggctgggc
aactcccaggggctgcaggggcagcccacgctgcgcctctacgcctccgagcatgtgcat
tcctccatcgacaaggatgtacgcatcgccggcatcggccaggacaacctggtcaagatc
cccaccgatgccgcccatgccatggacatgaaggccctggatgccgccatccgggccgat
cgcgaggccggccatctgcccgccggcatcatcctgtgcgtgggtggcaccggcatcggc
gcctgcgaccgcattgccgacggtgtggccgtggcccgggtacacggactgcccacccat
gtggacgccgcctgggccggttcggccatgatctgcccggaataccgccacctgtgggag
ggcatcgacggcgccgacagcatcgtcttcaacccccacaagtggctgggcgtgcagttt
gactgctcggtgcagttcctggccgaccctgcgcctcaggtgcgcaccctggggctgcgc
cccgagtatctgaagaccctgggcaaatcctcttccatgaccgatttcaatgagtggacc
gtgcccctgggccggcgctttcgggcgctgaagatctggttcaccctcagggcctatggg
ctggagggcctgcgccagcgcatccgcaatcatgtcacctgggcccaggagctggccaag
accctggccaccctgccgggcgttcaggtggtcaccctccctcagctatcccttttcagc
ttcgccctggagtccggcgacgccgccaccgagaccctgctcaagcgcatcaacgatgat
ggccgggtctatctcacccagacccgccatgatggccgcctcgtcatccgcgttcaggtg
gggcagttcgactgcacccgcgaggatgtcatgtgcgtgtaccaggtcgtgaaggaactg
ctttga

DBGET integrated database retrieval system