KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_3048Help
Entry
ECTOBSL9_3048     CDS       T04374                                 

Definition
(GenBank) methyltransferase
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00906  Carotenoid biosynthesis
ebs01100  Metabolic pathways
ebs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    ECTOBSL9_3048
Enzymes [BR:ebs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     ECTOBSL9_3048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_23 Methyltransf_25 HTH_20 MTS Methyltransf_24 HD_5
Motif
Other DBs
NCBI-ProteinID: ANB03398
UniProt: A0A167BEX6
Position
complement(3335034..3336170)
Genome map
AA seq 378 aa AA seqDB search
MATGSPSGALWRGGFLSLRNRILSSPAFQRWAAAFPLTRPIARRRARHLFDVVAGFVYSQ
VLYTCVRLKLLEHLHAQGPQTVPELARYLDLPEENCLLLLKAAASLKLTEYYGRGCYGLG
AQGAAMMANPGIAAMVDHHAMLYEDLVDPVGLLRGHYPQTRLGGYWAYAGDGPPTTLAGE
QITPYTRLMSISQQLVAEEILDAFNPKGYKRLMDLGGGNATFLSAVARRAPDIELVLYDL
PAVAEQARENFQGQGLAHRATAIGGDFFQDELPKGADLISLVRVVHDHNDDHILGLLRAV
REALPKDGALLLAEPMSGTRGAEPIGDAYFGIYLFAMGRGRPRTPVEIEILLRESGFSRV
RLLNTRNPLLTRVMLAQP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaggctcgccatccggagccctgtggcgcggcggttttctgtcgttgcgtaat
cgcatcctctccagccctgcctttcagcgctgggcggctgcattccctcttacccggccc
attgcccgtcggcgtgcccgtcacctgttcgatgtggttgctggctttgtctattcgcag
gtgctctacacctgcgtgcggctcaagctgctggaacatctgcacgctcagggcccgcaa
accgtgccagagttggctcggtatctggatctgcccgaggaaaactgcctgctgttgctc
aaggcggcggcttcgctcaagctgacggaatattacggtcgtggctgttacgggctgggc
gcgcagggggccgccatgatggccaatcccggtatcgctgccatggtggaccaccatgcc
atgctctacgaagacctggtggacccggtgggtctgctgcgcgggcattacccgcagacc
cggcttggggggtactgggcctacgccggggatggtccgcccacgacgctggcgggtgag
cagatcacgccgtatacccgactcatgtcgatctctcagcaattggtggcggaggaaatt
cttgatgccttcaaccccaagggctacaagcggctgatggacctggggggcggcaatgcc
acttttctatcagcggtagcccgtcgcgcgccggatatcgagctggtgctctacgacctg
ccggcggtggccgagcaggctcgggaaaatttccagggtcaggggttggcccatcgagcc
acggccataggcggggactttttccaggatgagctgcccaagggcgcggatctcatctcc
ctggtgcgcgtcgtccatgatcataatgacgaccacatcctggggctgcttcgcgccgtt
cgcgaggccttgccgaaggatggcgccctgctgttggcagaacccatgtccggcacccgg
ggtgccgagcccataggcgatgcctattttggcatttacctctttgccatggggcgtgga
cgccccagaacgcctgtcgaaatcgaaattttactaagagaatcagggtttagccgggtg
cgcttgctgaataccagaaaccccttattgacccgtgtcatgttggcccagccgtga

DBGET integrated database retrieval system