KEGG   Shimwellia blattae: EBL_c06710Help
Entry
EBL_c06710        CDS       T02111                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ebt  Shimwellia blattae
Pathway
ebt00260  Glycine, serine and threonine metabolism
ebt00630  Glyoxylate and dicarboxylate metabolism
ebt00670  One carbon pool by folate
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01130  Biosynthesis of antibiotics
ebt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c06710 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBL_c06710 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EBL_c06710 (gcvT)
Enzymes [BR:ebt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     EBL_c06710 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AFJ45795
UniProt: I2B5J1
Position
687062..688159
Genome map
AA seq 365 aa AA seqDB search
MAQQTPLFEQHNLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLHGS
RTREFLRYLLANDVAKLKTPGKALYSAMLNASAGVIDDLIVYFLSEDDFRLVVNSATREK
DLAWINEHAEHFGVTVTVRDDLALIAVQGPNAQAKAQTLFTEQQRQAVAGMKPFFGVQAG
DFFIATTGYTGEAGYEIALPKEQAATFWADLVKAGVKPCGLGARDTLRLEAGMNLYGQDM
DEGVSPLAANMGWTIAWEPQDRDFIGREKLEQQREKGTDTLVGLVMTEKGVLRSGLPVRF
FDEDGHCQEGVITSGTFSPTLGYSIALARAPAGAGKRAVVQIRNRELPVTVTKPVFVRAG
KPVAQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcagaccccgttatttgaacagcacaatttatgcggcgcgcgcatggtggac
ttccatggctggatgatgccgctgcattatggctcccagattgatgagcaccacgcggtg
cgcaccgatgcgggcatgttcgatgtgtcgcatatgaccattgtcgatttacacggcagc
cgcacccgcgaattcctgcgctacctgctggctaacgacgtggccaaactcaaaaccccc
ggtaaagccctctacagcgcaatgctgaacgcctccgccggtgtgattgacgatctgatt
gtctacttcctctctgaagatgacttccgcctggtggttaactccgccacccgtgaaaaa
gacctcgcctggattaacgaacacgcagagcactttggcgtgaccgttaccgtgcgcgac
gatctggcactgattgcggtgcagggcccgaacgcacaggcaaaagcgcaaaccctgttt
acggagcagcagcgccaggccgttgcgggcatgaaacccttcttcggcgtgcaggcgggg
gatttctttatcgccaccaccggctacaccggcgaagccgggtacgaaattgccctgcct
aaagagcaggcggctacattctgggcggatctggtcaaagccggggtcaaaccctgcggg
ctcggggcgcgcgatacgctgcgcctggaggccggtatgaatttatatggtcaggatatg
gacgagggcgtctccccgctggcggccaatatgggctggaccattgcctgggagccgcag
gatcgcgactttatcggccgtgaaaaactcgaacagcagcgtgaaaagggcaccgatacc
ctggtggggctggtgatgaccgaaaaaggcgtgctgcgcagcggcctgccggtgcgcttc
tttgatgaagacggccactgccaggaaggggttatcaccagcggcaccttttccccgacc
ctgggctacagtattgccctggcccgcgctccggccggtgccggtaagcgtgccgtggtc
cagatccgtaaccgcgagttaccggttacggtgactaaacccgtttttgttcgcgccggt
aaacccgtcgcgcagtaa

DBGET integrated database retrieval system