KEGG   Shimwellia blattae: EBL_c07850Help
Entry
EBL_c07850        CDS       T02111                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ebt  Shimwellia blattae
Pathway
ebt00071  Fatty acid degradation
ebt00280  Valine, leucine and isoleucine degradation
ebt00310  Lysine degradation
ebt00362  Benzoate degradation
ebt00380  Tryptophan metabolism
ebt00620  Pyruvate metabolism
ebt00630  Glyoxylate and dicarboxylate metabolism
ebt00640  Propanoate metabolism
ebt00650  Butanoate metabolism
ebt00900  Terpenoid backbone biosynthesis
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01130  Biosynthesis of antibiotics
ebt01200  Carbon metabolism
ebt01212  Fatty acid metabolism
ebt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c07850 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    EBL_c07850 (yqeF)
   00640 Propanoate metabolism
    EBL_c07850 (yqeF)
   00650 Butanoate metabolism
    EBL_c07850 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EBL_c07850 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    EBL_c07850 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EBL_c07850 (yqeF)
   00310 Lysine degradation
    EBL_c07850 (yqeF)
   00380 Tryptophan metabolism
    EBL_c07850 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EBL_c07850 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBL_c07850 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EBL_c07850 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebt04147]
    EBL_c07850 (yqeF)
Enzymes [BR:ebt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EBL_c07850 (yqeF)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EBL_c07850 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFJ45908
UniProt: I2B5V4
Position
793159..794337
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGGLAGHSAAELGAVVVKALLARSAIDPALVDEVILGQVLTAG
AGQNPARQTAVNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSQ
APHVLTNSRKGVHQGDAHLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
ASQRKARLAIDGGRFRDEIVPVIRETAHGPQVIDTDEQPRLDASEEGLATLPPSFDLLGS
VTAGNASSINDGAAAVMMMSASKAQELGLTVMARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWRLEDLDLIEANEAFAAQVLSVNKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMIKREASKGLATLCIGGGQGVALAIERG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtgattgtcggggcggcccggactcccattggctgctttcagggcggg
ctggcaggccacagcgcagcagagcttggcgctgtggtggtcaaagcgctgctggcgcgc
agcgctatcgatccggcgctggtggatgaagtcatcctcggccaggtgctgaccgcaggg
gccgggcaaaaccccgcccggcagaccgccgtgaacagtggcctgccctggtctgtttct
gccattaccattaatgacgtgtgcggctccgggctgaaggcgctgcacctggccacccag
gctatccagtgcggcgaggcggatgtggtaatcgcgggaggccaggaaaatatgagccag
gccccccatgtgctgaccaacagccgcaaaggggttcaccagggggatgcccacctgatc
gacagcctggtacatgacggcctgtgggatgcgtttaatgactaccatatgggggtcacg
gcggagaatctggcccgggagtatggcatcagccgtgagcttcaggatgcctatgcgctg
gcctctcagcgtaaggcccggctcgccatcgacggcgggcgctttcgtgacgagattgtc
ccggttatccgcgaaaccgcccatggcccccaggtgatagataccgacgagcagccgcgc
cttgatgccagcgaagaagggctggcaacgctgccgccctcttttgatctgctcgggagt
gtcaccgccggtaatgcctcctctattaatgatggtgccgccgcagtgatgatgatgagc
gccagcaaagcgcaggagctgggccttacggtgatggcgcggatccgcgccttcgccagt
gtgggggtcgatcctgcgctgatggggattgccccggtgtatgccacccggcgttgtctg
gagcgggtaggctggcgcctggaagatctggatctgattgaggccaacgaagcctttgcc
gcccaggtgctgtcggtaaataaattactggagtgggatgagcgcaaagtgaatgtgaat
ggcggcgccattgcccttgggcatccgataggcgcttccggttgccgtattctggtctca
ctggttcatgagatgatcaagcgcgaggccagcaaaggtctggcaacgttatgtatcggc
ggcggccagggggtggcgctggcgattgagcggggctga

DBGET integrated database retrieval system