KEGG   Shimwellia blattae: EBL_c11480
Entry
EBL_c11480        CDS       T02111                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ebt  Shimwellia blattae
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebt02044]
    EBL_c11480
Secretion system [BR:ebt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EBL_c11480
SSDB
Motif
Pfam: T6SS_VipA FIN1
Other DBs
NCBI-ProteinID: AFJ46252
UniProt: I2B6U8
Position
1179502..1179999
AA seq 165 aa
MAESFQNEVPKARINLKLDLHTGGASKKTELPLKLLIAGDFSNGQESAPLPERKKVNLNK
NNIDAVLFEYSPKVNLTVKNTLAGDGSEDNISLIFRSMKDFSPEQVSRQIPQLKAMLSMR
NLLRDLKANLLDNQAFRKELEKILLDPALSAELREELSALAPKQP
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctgagagtttccagaatgaagtgcccaaagcacgtattaatctaaaacttgacctg
catacggggggcgcaagcaagaaaactgaacttcccctgaaattacttattgcaggcgac
ttcagtaatggtcaggagtccgcgccattaccggagcgtaaaaaagttaatctgaacaaa
aataatattgatgcagttcttttcgaatattctccaaaagtaaaccttaccgttaaaaat
acgctggccggtgacggtagcgaagacaatatcagcctgatattccggagcatgaaggat
ttctctccggagcaggtctcccggcaaatacctcagctcaaggcgatgctttccatgcgc
aatttgctgcgcgatttaaaagcaaacctgctggacaaccaggccttccgaaaagagctg
gagaagatcctgctcgacccggcattaagcgccgaactccgggaggagctctccgccctg
gcaccgaaacagccataa

DBGET integrated database retrieval system