KEGG   Shimwellia blattae: EBL_c11490
Entry
EBL_c11490        CDS       T02111                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ebt  Shimwellia blattae
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebt02044]
    EBL_c11490
Secretion system [BR:ebt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EBL_c11490
SSDB
Motif
Pfam: VipB VipB_2 APG6 PaaA_PaaC
Other DBs
NCBI-ProteinID: AFJ46253
UniProt: I2B6U9
Position
1180039..1181580
AA seq 513 aa
MSVKNEHAAGGESVVLERPAAGGVYASLFEKINLSPVSELSALDIWQDAQAMSDATADER
LTAGMQVFLECLKKSGSKIEKLDKTLIDHHIAELDYQISRQLDAVMHSEEFQAVESLWRG
VKSLVDKTDFRQNVKVELLDMSKEDLRQDFEDSPEIVQSGLYKHTYIDEYDTPGGEPIAA
LISAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPTFFFRDSMEDVAAIKDIGNYFDR
AEYIKWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHNKYLWTSA
AFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREF
EFASLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDARVVVEDIEDNP
GFFRVKLYAIPHFQVEGMDVNLSLVSRMPKAKS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtctgtaaaaaatgagcatgccgctggcggcgagagtgtggtacttgagcgccctgcc
gcgggcggggtttatgcgtccctgtttgaaaaaatcaatctcagcccggtgtctgagctg
agcgccctggatatctggcaggatgcgcaggcgatgtcggatgccaccgctgatgagcgg
ttaaccgccggaatgcaggtgttcctggagtgccttaaaaaatcgggctcaaaaattgaa
aagctcgataaaacgctgattgatcaccatatcgcggagctggactaccagattagccgc
cagctggatgcggtaatgcacagcgaagaatttcaggcggtggagagcctgtggcgcggc
gtgaagtcgctggtcgataaaacggattttcgccagaacgtgaaagtggaactcctggat
atgtcgaaagaggatctgcgccaggacttcgaagacagcccggaaattgtccagagcggg
ttgtataaacacacctatattgatgagtacgacaccccgggcggcgagccgattgcggca
ctgatttccgcttatgaatttgacgcatccgcccaggatgttgccctgctgcgcaatatt
tcgaaagtgtctgccgccgcgcatatgccgtttatcggctccgcaggcccgacgtttttc
ttccgggactccatggaagatgtggcggccatcaaggatatcggtaactactttgaccgc
gccgagtacatcaagtggaaatccttccgtgagaccgacgacgcccgctatatcggcctg
gtgatgccgcgcgtactgggccgcctgccgtatggtccggacaccgtgccggtgcgcagt
tttaactacgttgaagaagtgaaaggcccggaccacaacaaatatctctggaccagtgcc
gctttcgcttttgcatccaacatggtgcgcagcttcattaacaacggctggtgtgtccag
atccgtggcccacaggccggtggtgcggtgcaggatctgcccatccatctgtacgatctg
gggaccgggaatcaggtgaagatcccgtctgaagtgatgattccggagacccgcgaattt
gaattcgccagcctggggttcatccctttgtcgtactacaaaaaccgcgactacgcgtgc
ttcttctcggcaaactccacccagaaaccggcgctgtatgacactgcggatgcgacggcg
aacagccgcatcaacgcccgcctgccgtacatcttcctgctgtcgcgtatcgcccattac
ctgaagatgattcagcgtgaaaacatcggcaccaccaaggaccggcgtttgctggagctg
gagcttaacacctgggtgcgcagcctggtgacggagatgaccgatccgggcgacgagctg
caggcttctcacccgctgcgtgatgccagagtggtggtggaagacattgaggataacccg
gggttcttccgcgtgaagctgtacgccatcccgcacttccaggtggaaggtatggacgtc
aacctgtcactggtttcccggatgccgaaggcgaaatcgtaa

DBGET integrated database retrieval system